2011_AACC_AbstractsN]pN]pBOOKMOBI:?GSPWW _ h=pyKAXPvG| M"$u&ʩ(V*,.0224"6,8 :<]>$@,B5D<FEHNJWL`NhPqRzTVX_Z\^`b)dČfɍhjln!pbrtv xLz|#~+3<AG6OX`shqey-U[@&' s(0\80@GQ<Xaiq{Qll`F8&ՇEfa0!*3T9~AI P0 X`{gnv2~eU:  "$&(]*Կ,9.024m684:< >)@@2sB;QDD>FLhHSJYLb-NjPs.R{T`VPXZl\Z^`bdhfh٫jvlnGprt vxz&z|/~8@I_RZQchk so|"YmGy6xW{E "+4 G&@ OB WD _F hrH q:J yL N P 6R T lV kX LZ z\ G^ 9` xb ןd Of {h j l n p r t zv (>x /z 8| A~ J RI ZI b0 jZ r {    [     3 ; r q    : Q  4 "! * 3 < E\ M< T \) e  m' u] | [    G   H Ã  3 [         '. / 7 @* H O Xq ` h o w   &    =    ;  " $ V& ( * , }. 0 $A2 -d4 56 >8 F(: N< V> _B@ gB pD yQF H J L N zP ~R T V X &Z \ ۿ^ O` b ed f;hjl 3n(p1zr9tAvIxRrz[@|c~lu}:D( sIX P$,51>F8OoWo_htpAyd)agp?_jh'/8>@IRa[ c&kt7| 1 O Lϒl߲Y g" $ &(&*-,6.>0E2M4T6\8dw:m3<u>~@~BtDsFHJLvNPsRT׫VߡXOZ\^`bLdTf!h*?j2Al9bnApJrStZ4v`Uxhzn|s~x}<vtvR/DeWt np#(-37<AkFmLQwW\b9gmsHx~~Ve6&̫7  Y3 /`) "m$&(m**,Q.02A436_8b:!<3J>\@޺BDFyH J ?]L w\N P IR!1&T!)V"BUX"Z#\#^$H8`$$b%(d%f& "h&5j&yl&wn'mp'r't(ZJv(zx( z(b|)P~**]+:+u++,5_,!-#r-]-M..V//̘0 060mm0n1^22y2D3r*34[<5<5 6U66x6M7*7f789Qg9:::; ;E;z';>6>ݢ?/??3?W?ƒ'MOBI%% PEXTH d AACC2011 AACC Abstractsj!2011-08-30T23:15:26+00:00l2calibre (0.8.2) [http://calibre-ebook.com]q,e9765eda-534a-49fc-ad44-d022325e53d2 EBOKj!2011-08-30T23:15:26+00:00  n2011 AACC Abstracts
Abstrac8/uȁ!8a#blockquoteooooi895oohTuesdayM,uly 26ǁ>, 10:00m - 12:30m׈VπȆ508WznimallinicIhemiywooτ22967Car/Tumorarkerτׄooׄׄׄׄׄׄ238630ׄׄElectrolytes/Bloodas/MetaboliGGGoGGGGGB308399GG@F`orsffingestesul/'o'''υ''$419628'' Managem脇o505182Pediatric/FxGGGoG7g磟yУoǣ2p4 υφO DM/Toxigy/DAU?oooDŽDŽDŽDŽDŽ745516DŽǔ)oularathProbOoυ85760+sspme ppltion''o''''''#931193'' Nu/T e͙s/Vitami//ǀo//ττ1018531ττWedn_7ǁ׽__]יׅυϊϊ//1872_krcG'wwog145334Autom"/Computerϔυ7o777υ77523177ۮStudiOutc8o38209Lipids/8oprHgσ?oτϙgook44574?og'gׁ׳''mDžφ5PGGoint-of-eestingWo߄߄߄߄߄56681߄ڎ/Enzy'oτ6/echnesignevelopmentoW72448υInfiousiseaseDŽDŽǀoǙgg`891289ggyhuro 8wϙ9aXZDžoφpos=0001891478>Endocringy/Hormones XAbstract////+у777>TuesdayM,uly 26߂>PosteressH:  10:00m - 12:30mh9 AnimallinicIhemip<>A-01gg_^Valid"fhewo-CnalysisMouseОxeletctivKitymfrɁticsinssng Ђ mice.X.ove/bx,.andya2WescottBous. Brol-Myersquibb,бceton,J,ewrunswick br(Mե@r8condis,Fsecomeedugma,owever,y힀also߁uzpa`0⃯esultᔐclotp.rto|jp(ntiHythromboe lismAprecEastudiea҅pwaseedevaluoonԝ_____Z ammercparproductnufuߞ,ibeldt,e(nyktaiPEaH0JON/AtibodndITCWug.E9.bindHo톢integ αIIb/βIIIap،iȍhangƞXwith,P-Sn (CD62P)Vlpharolesx`Cnsfer9 meljapursixp*orkloodcol1YPde aortaaloasyɊ:3.2%odiumitA 9:1ib򘹍coagulPzmixg8Hin09Pside YXpporubEquvolum OK8ermHye(syYgonpʎX(’0bilitydet??ConvulxJhouitabl $dppriqH! (1.43 μg/ml)adʛUA/silu)1:25difiTyes-HepBuf8jCalc)ChpХ|aXllq96[rotitߊ[5/ŅtJat>35 µlÂyHub15(nto1empe:ᕒ/H("L9ogBSɸ`preaSampI2azIsFACSCXoIlowytX30.׆Amediflu1ؔق'Oxp𤏊Xfol胷`mҌ`zws(im)sA 11y23DŽÁ(ǧ%[a 14I51OOOOUwRepl`2i$s=@87%nndicationhathelateletsrenctivdt8semonstrbysignificantcreasfluorescenceitho(JON/Adug.E9Xtibodies.
A-02g`__M Yj@0ImmunoradiometricssaoupporowolumeamplesrequentlyncountCSafetymHj=C.TARKS. HUNTINGDONIFECIENCES,ASTILLSTONE,J, maqxndcur@ifilX,8ps,luĈarrixff3invgY qutrols (QCs)vidS-hpoo<*-gesultgˬra-byXom#36onuآrang٪2.7-5.8%c"van(CV):QCބIY4.7%endogens.əÑjzepaBgAt@aHthreid(6.2-11.2%V440.5†G.Ĕ'&yiw0tчxyߪmٖJ1:21:4n1ea ҩxaccepHcaߦ(nHлThX(tory(chez>taskɚ !mi!ɅQ{cB>[+h9FldesigQaiexP0su0riz apXa(ɋdeps0aPbg1romQoXlhxy)aiaafeticularDqudϩצzubsab"ȷa"eav(meeٖۂфharuٳSbio kH`΂studyll,IU@y`tmetho'ٚQ7ALPCORMAb_Lpurpok exꂓ큱



,.okoba,ȃkenag2Y.oder3煫Oh-.ak߁4Maed߁߃ρ߁߇Aokׁ5ׁׁP`.armines 6KatagirG. Kitasatoniversitychoolflliedealthiences,Ӓmihara,apan,''')'' linic,tawςςςiaςρ׆׆׆d_ɃSamaedicaly,rum0MecomHhPNebrask`ollegebmahNExbr()Mackground:0b>Duringearly(diabetese(tus (DM),xlort"productionnitricxide (NO)nduperanQ(O舏Wb•->)sncreased,eadroyzteorma"+gOp>→ONOa߁߁فǁdžhaxenha+Hteinyrossidu8y 3-o(3-NTaႀPhatayhn@buPdevelopmeFnephropathy@ngin-(tenzym`ACEnhibitorpreviousu`xclus耈x thyohaveeen (d`pas`itixHrapDM{cel׆׆׆iHAoutg`._Objeve:pirstotstudx(evaluIo@s(he(pssapHNTnhIX(texD1sx??;rify7.qs;re0HDM-in[̆׀ds>FourpfIxnQ=6y)er`xned: 1)TZ:ˆ2kftbQreptozoto!, 65g/kgpi>i.pQ.2iivMvehicl3+ENALHapril (iHn10dkwr 43ǃa-"1.ɒHachq,asulooxlucosX{:9ar @rxϫOOOwO>OjBHsxllAsmut(SODAᆸx.ҘϘɗhI48om8ayGxsults:‹_lI鄀higqA( ׁYP <0.050X0gǨáyfdiot@ffhamo.Ր//,0mpaq"js |qh J袛WRgߔgǔggggp>GGg: ߇ߜBol;owjpheno5X)W 3OD櫴r7<ț(furGoooSTZ).garose 2-dimensionalellectrophoresisndesternlottingevealed0han 20potsithositiveti-3-NT-immunxacityne`cortexfSTZroup.ԀxuPLC-MS/MS,EQUESTlgorm:Swiss-Prot(esequenceatabases煸tNALnspicuouslyntencHnitrat( rees:it 2 (ACO2),lutamatehydrog01 (GLUD1)al/+6amily,emberALDH6A1).
>ACEhib:ciagaxtM-indupjtyine,ff`smay`sultromupssoxid (O2)'#Ɠm(id9SODxI !`houHtoxbJ-sY‘duraDMqidmitochondria,nowoemWϊWWWWWp>hileǕRoha`y0yauJ9bsersggpa%/:u@byw8РfulAdlopdiagnociomarkerrapeumethodcxemployx\yearXstagڍ(rl`fbe1neph athy.A-05gb__RanqCommon0Evalu`dhemistryHeologyara؈jClinicy0al@ynomolgusonkey+hOrigin'''$u>W.Qrry
,.(tzbTrimbleHi>CovQaboXhes,ler,Z,iȧBack!ndਖh pceƧccst w` m`dchnaïc (Macaca)fascPls)/H*.Msah兀q݄D2.5-9.1sfv9uHei`ubYnojcoagxfcwosiEDTA~.GAanalylizaҩxedٹiesdvia 2120?;ǹ_oraHhelpԥablisؠypXOOOOOq釀einewP(lsһҐ>7521677?6_^Morph*񚉪IntȗIPRatsƗPhyIAcidxtrac SweetТ`( >Ipeaaр)777L.ilworth1@8ׁ׀Uni sityyWh ona,˩ston,ama 06~Tex`A&h;MՃ,rpCh@ti,X0ݬ^Background:ai1rAm@s rwhi0fypZseedmanyoors.tlobeenognȁY-nutbecausefts abilityoind@,recipitateဠdecreasehvailofanymportantineralsuchsalcium,ron,xgneszinctc.imrlyhyticcidnterferesithctivitisomenzymbyingqhmiXtly.nddoneLYesojlsoughtregul)procesdigesRductmak2un,leorbsorp.oweverxtnotlearfr chan8*nal0hologysocidۇW upplemenzhaayurontribuыJPQibloodlucose.
+ 0Tuesd8AM,uP26Ȃb>Po`rӇ1  10:00m - 12:30m6a8 Cancer/Tuͭ߄>A-08g?_^DiscohSerBioYPridulmRNAi`rehValidr8teMhurzrTissȁbDžDžDžu>E..lee,.onda@MHmanson,.yS.rdogaBergalh"yeG. Mayolinic oc`8N,iBacknd:״јaadingureldeapȉ.SA삘ssensi\ٛ2accu9ent)Hneeqidxifyoa`񖑀Xm8ftؿear8(gnos0ttey؊xpas(ztobtad+ғIwh dȩcouldx3ic@nlɕhdqÁopay#OKxwM:Ƈam؂1cYp`*{bowhhǓo@,-grraepelneoplasiauig_QerwѓʼnaGcSPOR8EG;"x(htPicrosh£wexhh(ZڣRbAffyXrix133lus 2.0arrchipNҏȨcsel#6Մn0diHX@)oԄpecificxpressionfheredictedPoteinsasonfirmbymmunohistochem@ry (13)ndasspectrome5).Ԃ0centratscidaterkersnlooderevaludsing܃ays (8targe!߃toeasuXpeptide9RabbitHti-Ԁjsera+develop.synXticWjugJKLHN belycosyl{xferumithÉanaxA.ddi1al1aliquotpplabundG3MARS14lumns seamsanc8p-digesC-//a_XnPI 5000gcerorisotopicallyabels.
A-10g`__Adw񥱋mHoly0p`m2inleuk18eъpoccur؀(g'hChinHPpop!hJ.iu,ʀDM.ei,.hoX , B.٢Huang. We81aospitangd ,picMethod:xh0-olmeM)1iLqCycl480ceS)softwotyp`zsleǎ(SNPsB234ga@sߊr244Htontrol 8x:analyhbyPSS 13.0IXR9haplswp(2hIPearsHχ2ۄ@Yodd (OR;95%fZ (CI)duc1riskpcrosstabs.

esult:>oignificantifferencesHbservedetweenasandontrolsnherequiofwoNPenotypes.utWPyAalleleÂ9-607C/Aashigherpatiegroup (χ2=16.424, p<0.001,R= 1.702, 95%Ip315-2.203).-137CaplJassociatwithᄇntlyecreXdiskAprostr (0.478;: x35-0.526;~(01i__Zdetecy(:distributionboqIpolymorphismclin@ltagKmetapsiPHowever,q~!HRPC6.538 38),2ŃIfouoHόυȑ\6.7101.999.176-3.398)onclus:uratamptrzpotiЙfIL-18e}ǑǑ5nsij0horXetQAChineseaopul,espe lx.

A-11gb__Pheal0index:`e-analytphu>F.eriotti,.Уillo,ǀhizzagi.Diagn(Hi؀PSHRaffa؂ilan,tЌBackqnd:І (PHI)頨ewra`Xpo!byeckm-Pevaluz.oXlcs,ZmHuremКToSASAFreef[-2]0p2neededpreviousi`at*atрkh8storroomemp“ch”seeumoryZ3@urxim (SemjonowAimork chȡh0nvB/lp8a8zocomlimi8Wethods:TexiӸxfX1.BDacutap‡+oxSSTIp2.o-@ath.ۨ cohfr25Es;alu)r!cprifuǵE@90inutairsliquot2tak0zYt -80 °C{'lefHwv(2123)0r 5 ,!seco:OOOOHA-12gb__Moniingp8elialancerssmicroRNAsrSerumu>S.ruong,.bbert,.astien,.tijlemapPernard. UnisityyUtah,altakeÀ,T,$2'''&N:BOہPsLLp׎/----ׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁ׍w-720׀572wwwwwׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁׁ׎ϣτos-516a-5p-1225 45wwwwwρׁׁt="0pt"idth="0`>----

Lungׁׁׁ׈663mwwwwwwwwwwwwWgWR225wn129ǂ98(able>onclusion:>eavedentifiedniqueetfcroRNAshatanesXforceronitoring,n0reotallyfuleardetect`.1υ̅pAg'_ZPreliminarynvestigaIithe8rBetweenNMtageCircungumCellsuntn̚ÇP@8HQ.henP/a, WuiPekUnMedicallle Hospital,ijChx Dh@t`CytigXpor,ӃpDiegoAfBackgrd:numec_ZcZ(CTCs)ayquIl靼treatmž/ppse. istudy,wexplohњτττtosleveAmarkersTsth'er.GMethods:3rH1ve,Hngle-c(ȃ ampІP脏42WRepg) recurromM'%.Yomȇsuchᣨyfra21-1,SEA199:25:538EAAFPxalsoeasured.Ԇh-node-metasH(8)Bwpermba1sulhimologyhr_ҁs:‚1~2150%(4/8)iyT1Hhi≥3ZmajXttate 46.2% (6/13), 62.5p5ia600)A* 24܇ly1 @AM1^<䗎Idoт5׈׈׎ rI"54H177߅߅IIV Xsotth|ρρVa 10Hposiх(10ch/)cZiosow(94.12%s. 66.67%).
A-148g`__Rshipetween iIntegrins@iRNA-polypphismprogrpg ricancinhieanpuCM.ei,.iuEBWang, B.ing. `DepartmepLaboratoryedicP,staospital,ichuUnrs,hengdjxʓBackgroundiderablevolui9recstudisugg@atslayr0caloHGC.anychanhaveelucid+'!con buolihdon,8gioisXextraJ.€des,cPyhgAуexpqthpghpst-XnsxpoPButssocibspڕ}riskhnotKclarified.our*0im examherw,s1062484iITGA3766GA61902171Av3809865Bs267ـɀ5,werw߈gnrQ8v`ata`Љp(-ڟ/ӭthods:ۅ327pXs (222xH105eyPepage: 51.13±11.06ears)colh irotypefrequencqhromotyObyJe;melt(HRM)nCyclx480c:GSОftware0PSS 13.0us(taywesultvohgn thff @observȜݺyiSNPpinAJclin2 g`How@r,//det{1 p(epHF(: χ2=774`i>p=0.032;1.84908).`R'shdamo0FappɂiA_[3.916wq48;0o)cl`IyJ77~iIuschibilh,ټt/WR/.g

.YDepartmLaboratoMedic,estaXspital,SichuUn!s,hengdHbp4Backnd:icroКhaXb1I imporRY.XwR8lopmhumbexs؀872()bЄsul`h𙨶ducSrff@target9ethuseaH+seaКudoxplobhip΅C* (910164>C)3746444ԀhWU”_]غs: 186W__@PZ483 althySolen`lSb x臉er01ea꿙Jfragl@?sm (PCR-RFLP(TȺl)[fircom8Ǩb|,rnsub$LƆprPerizSohologfurrH(wlsoهigBecqіInTfun+gef onset.
Table1 .>wsǃb

7et(n=174)څI_^GY02߃/Omean±SDςWWWSP-XueO?WWWW߉߂CGwǁǁǁǁ85±14.38ςwwwsb*Ƃ//'&GsCE/.()L1'%b>A-16hg__UtilitySerumiomarkersorredictingystemicogressionnystateancerσσσu>M..oodmanson,.׀lee,̀Hohli,.ʀharnes"pBergstralh,ǂH. MayolinicocherN,i_NACKGROUND:anyenhoreiagnosed thcavelowlyۉdiseasHwhilomeapidGsnd multip@complicatscludzeathl7thatulddentiflikePtowrb`*Pysefule=i19_romeatuchdotal thisȇYe8udheir clinicaltilityorredictingdverseutcomesnohortfenithighiskostateancer.́'%wereelectedthistonsuthathadXequeventspthellowpime.
A-17hg`__V!eealIndex (ZiqphiÀr)L..okh؆,̶s2Mؒa߁߁3߁߁؅Weiρρ4ρρG.leeׁׁ5ׁׁC.angm6KPlawinăroyle8ShׁׁׁׁаPCruzׁׁׁׁɐizrapWha,Robert_9R.a!haik'll>,.artin1. 2wwrUCLA,osngeleC3zBethsraeleaconesCenterostonȃWWWP4WWniversityfichigaAnnrbo8MIi>5Mayolinic,ochesMNi>6ErasmusՅ߈׈Rot@dam,ΊXerland7Vanguardrologic6endexasra=HouTXi>8dckmanoulcorporHd0arlsbaQ7'' 9''"ARUPaxatoriSȀkp,T`NorthwnǂChgo,Lbr)Mckground:>SAevelsorrelpoorlyirepeatiopsy (Bx)indings.퟈pecif`tdelpetectCamongenv afyrnegatx.evalu :0l >He @ndex phi,-2]pro(/freerxqeooSpf)nbXergoprHHybrih2measuresA.Mods: 865from 7؊_gBx,eX(enled.luscIria: ≥ 50earfge1Y2-10g/mxɁ6!X159adᇇ (34%A); 706ð؅y (51.erumamp02фq*obtain pripto077Acc2mmunoassayalyzerOOLGOCsermwRespI[havልٓ(aurp(AUC/0.7140.553(p<0.01OKδ(UC0.63700.ʟisignantbe)(9/eQ-FxboXttuhXsenXiv.ett 60%π64.8%Ǡ%`ނςCutoff?O77777OO///ςς85wǁǁǁǁ27.1ׁׁׁׁׁ43.2ׁׁׁׁׁ3.4ρρρρυj0.9׉60wǁǁǁdž 7.ׁׁׁׁ">71ׁׁׁׁ׋|.6ρρρρρ7.8׉Wǁǁǁǁ4߁ׁׁׁז4'ׁׁׁׁ5Wρρρϐ2W ׃align="top">%ensitivity

asmprovedOelaeoУHforenndergoingirstimerpeatx.vHthough8eǂof>somewhdecreasHi_X,discriminateux/-till`Iantlyetter anandPideshort`olenewarker.susmall>1A-1HbhgW_XDevelopx(analytldpjst-Etig ()say (NADiA®Ѓ0Vue™),:(immuno-PCRechnolog0???:u>JP.cDermedׄד,.Ӊ 0,.oosaipai////8Klem.ʆrnoP.iami.7iiׁi>Iris͡cular1gnHics,arlsbadPA,///ك//Mou`Siospital,orXo,NInada!vMackgr8d:S"ensur٩tzfreEancpx-ctomy.8wr,on0Ixs@ien+oHiru:uXlnXxtPuishIwehs쟘bغ"slow.ԂobjExstudyd;e†Ѓg:uly®)thub-pg/mLF,Mm@Sserum$`OLP`sl0@Medsb>yˉ0capt;Wbhnـ8onoclCHbohichZinylAdobilstreptain-co:pargne`i8lesdeachemѐXju0pa 59-mpdou9ЪdNAligonu@xde (ds).ftiIatwompary=ie҆Gc`adhlse!,zn҃axpoly0a@reac(h gccitorSYBRnlusceKaѷin`u1th@holdyН΂sigi!alculatedndsedoronstructinghealibrationurve.
:>ց`d[experimentsereerm8accordoLSIuidelines,henvailable.ssayynamicangetendrom 0.65Y100g/mL.ԅlimitfetewasp27;ȇVquantific#{肴Spikrecoveryithixerumamples+86%5%aeany98.4%.iluarityielV84911p1allv1dNADiAosVue = -0.16+(99 (J);arsR@4.eurfi:!re cPʇboYU{sbe 0-4 onclu,aHimmuno-PCR0nJ!mostnhjKaalytXlƖrporttsur[Chexcell1harac8icЬZUgipropH1aiꆡ/ɑuciskst!caٳ{afctomHAㄐevalQt{Hurw`supul9y(.

(A-19Agb__AnţnReonoclopammopathycn1Arr8I-I pu>R.udd,Đ`aylor,.arleSZ,.ead. BinS@td,rmham,ndˀdom,:>oncordanct48BDS 96ifromatientsithpreviouslyonfirm monoclogammohy.ԇassaYrrnormFLCH@iosn/bt95/H(99%)hyamplAoneist|Bequ(toe#3+polythyperaglobulinemia,ut8dicnf7litmeanin-Scis(croef0"Pvari)elevennsse%16pl8three=:gAκ=4.1%,b=3.9bM6.2d=7.6bG3d7`κ4aa5"beta-2-micro} 5cystn-ˏlbɁ9%ǖBlon݀犠s@atae| potimJ2iscn.ŋ3(erbtadceache144 (1584poitotal)GytiliDynexS2lathifulXauZi,[ ɀiA-20ga__ EffYAge-AdjuPSAngiro eȌ`IndX(ZiqphiÀr)W..obergf10esAsX` tableЗmtario7i0obta"unIH;q27.ddPolzXȂ瀬$ (0.525s. P14)648645ȅGA703718).%ӓЊx="3NotYWςςχӱWWWW>*i)Rp?????O?OOO?g95ρρρρρ8.4ρρρρρ16.0ׁׁׁׁׅgρρρρ>7.2ρρρρυb5.7׍ooo|1߁ׁׁׁׁ8ׁׁׁׁׁ26ׁׁׁׅv9ׁׁׁׁבׁׁׁׁ31.1׍8O7ׁׁׁ׋7ׁn="top">39.0

17.1ׁׁׁׁׁ27ׁׁׁׁ42.3/trr8Xb`Hׁׁׁ׋6.6ׁׁׁׁ׈5.2ׁׁׁׁׅr1ׁׁׁׁׅt4_ׁׁׁׅt8.5׍/table؀a)onclusion:heesultsfhisPuatootupporteeedosege-adjustPSAangesor phi.ensitivity,pecificjandUCromROCalys@arimprov withlifying*pcrosllroups (≥ 50ears).(mx>A-2؟ComparisSHybritech®rWHOØXbrkfId%BeckmaneH8tateeal`I@x (i鐊9r)Canc(De醏u>L.ʗ(okollGGߌGF,...0nchaikWW߂WV,.͎q߁ߐo߁͆a߁߁4߁߁؇Weiρρ̥pρ.leeׁׁԮׁ.£Xm/,ˇPlawin7Droyle8ShׁׁׁׁA.ruzׁׁׁׁɐizrapWha,RobX_9PartoρCatalon0`ȁׁ׀JohHopki@Medicalstituj,ltimoreD,wwwwwErasmusnryCerot@dam,e`rlUCLXLos(8BsraDeacone/+Bon`WWWP(WWɉ'MichigaAnnrbo8MIiQMayolinicchesMNi1Vuardrologic6eBTexasljuHou{TXiʺInc.`arlsbad랸ARUPaatori)Sk8,T(NorthwnChgopLr)Mckground:Sinceheid 1990ygo@Xeqular!@forSAvolvedntodopYWHO 96/670sewa0.9,fa,68,eBoЅHybech:"ayalib0reas(refereprepa%huɂoHpurififromeminpla2valussign8bywryo oteinpods.ԅobjectthiudy2comc‚Hlp (aqb[-2],OH)singlj€1onsorSAndH.he-2]proisoformaseasuredsingPHybritech2Bssay.
** ((*/)؅ 1/2ӄ߄݆wHEiona babHde0_`bootstrap0chniquoepetilyampl>popul 1,000im`accou[25%evalenceinGarangeGsG>regr(v؉F))1serusc0-1UreeprimarP(lhowXoreA ar4.9814IP999.4.Ŏ'equals 3.1Tbas؃(POC/ϑͥGvirtid0wh3eHϚGՇAUC 0.703Q4 (p-ue=0.53)َZϕ(RbRisk),je8similarwG__kFw9k-24.985.0-3Z3Y5X"5,_\oϊϣc11.0%P3%R: zboth@18.1$8q$6'2.7#@%3Gp52]49.6<4.7.4P p`LćHpXsfouooo,x!26.8%b8d1.429.8)Z.13Dž¢WConclXonϘth1absoluteiff o@ЅԀ†Xc aܻ׻ӁsiBtO!ϊ5/seapp񿃂_A,JssaypSImmunoystem8VAPbtaztanufxurersnnot Pircgeabg(sup(m>*A-23`Xg`__AssocibetwePmicroRNAencariasusceptiĐ0color(cChDX,.ia,.׀J.hou, B.ٖhw.Departm0b>Ms (miA)l importHol phoYstumorPSnucle0daly(sm (SNP)@Ci(otypYunontpanalyz0shiptwoPNpɃ(CRC)'GXC/MedsUbzerarep-HtribagXg`/)PCR-RFLPw):x0,-146a (Prs2910164>C949943746444ԁ7276RCW(65.2%fe373althy9t 7A21diabuEpe܎JcomeRpYmosub@zolog2feaR:BoЅXφύ&whsignifntbetweenatientsndontrols.owever,singGenotypeseference,heistributionf_GGxsignificantlyighernthan (p=0.031)ith?nt(sociCRC (OR= 1.762; 95%I =1.050-2.956).urrmor؃goodu膐ftshd 100%(miR-146a,utmoderateroׂhadn22.6%2Ѓ ph,,xspectively.OObbetweenɉ!det 0.553,0.315-0.971I >OuPatuggesA tzlocu+rs2910164>C)6a{ also st,bita efulscr9-risk(pulۊ`wellArmpdiagnosٔUOTable 1oly0p@mss(֋iP؊)IAՁ374644>T>9Kp>sm"n (%ggggg">ggggggfχ2ρρρρρɱ=*ORǁǁǁǁǁӁN;(n=200/瀿oG_ooXǁǁǁǁ">84 (42.Ɂ">142 (38.1rowspa3Oggg`5.413??????;0.067??????;N/A////////w+GwǁǁǁǏ*(41/-87 (50/o/ooǁǁǁǁ317o41.8g'gfs.ÆWooo>4.6߁߁߁߯b3171.76.050-2.956GWWWCCWoool2.4QO߁߁߁ߥ111/߁߁߁ߜ{.349߁߁߁߁߃928-1.97Allelρ߀ign="top"> G0.045??????=832??????.028??????u799-1.321o7ǂCozy624713.1o/ors3746444T>C(n=21)iO瀿xenotype_ooǁǁǁǁ¢`2.402.73___214??????^99??????;N/A///////oTwǁǁǁǢ9(3.2/821.7g'gTgǁǁǁǹ7 (74.4ws825.6w/wAllelρ7φo緿'514.ׁ1(137227___045??????33??????.038??????u734-1.467oo7o363(86o645o\/table>,i>Notvail;R,ddatios.2_1gdA-2hbg_XDetectingircul(`tumorellsromicrofluidichipsYaustomizedmagp@form///,u>W.arneyA-25Ppg`__CompPsThre8ommercCmogrnssay ReLabooPMethodsu>E.0ineku>,ʧ8uch0X.ڊg,.a Cl Cb,@,H, A-260Pg`__Turbidi@ricmmunoassaysIgGIκ `9qua’끊s8s%;ipyma___[A.ʊlvi1NFourrier''''&aBinSiterouptd.,IRMINGHAM,ndˁHdomȃPDiviIity2Inf, Mlchool`yBirmPhaP7769͢Q\oclonAsglobus❠erum:eelhropho(SPE)0nȠ8u)71h0lytWQ츐lFurePEoтouxcpX-depenabomZoXs}8ha`tocr(olumpecWl@tibodihabeeroducrecognHQ(Heppsp`jun avsli_Zmo ulhH esaحt777geppSPAؙ>PLUSb>™,H,nch-' ā@Ƅ/ÐBsus@niҁdiagn؋:"_gammoh.Zm1ayOLm iICbpw order"bgn="Ptrd__Aᴾ/td /t瀏ǂǂ>Measur9r9 (g/L)____Y1.9-40.00.92-29.5'Sampdilui߂/////2ׁׁׁׁ׆kςOOOϾρρρρρφ>Senׄ???.094߁߁߁߁߁46߆R ((s????:?___op">Linearity

y = 0.987x -H42g/L2

4"//>Between-d//753/r/OOOǂǂǕ///GI/OZ/GGG//8/7TotalOOOM625.9?ǂǂǂǔ76zGGG>7' 10W/table>PLUSA-27gb__TRareCyte™ystemornumenYcirculx@tumcellsatetainsllucleated aanalyse(doesn’lynapturproteYexIs8 QA.xmirez1J.̂tilwP'''&. ,nc(ssaquah,AǂǂƆǂǁUniversit fashtonHtlpbr)Mackground:etecJmoleYharacterizGGG8(CTCs)bloodᕀpowerAmethodcdiagnosq0diroҘ;`rapeuticHsponsigna8s.oshechnologi8currHeevpmba͚םpCAMri|markhefficcRT/eris-ohrTCGpsepfsXa(fosurfadesimag.Mk:kBr3Hikiywh8dfromalthydividuacol`IIrvtubh(Streck).linic`samcaprZobbyakleft-rm`Vhdex`,K+ev ibodzonjugDyL 547,lexaFluP488or6Ɏhy,incuP`2њop%mixadd+aaloer,l'm.ԕbp3zcrifugēe'=qRBCplaXop wqy}layC℃8ed,c1JutomtmesultIn 14-)10Q2504-0@86% 隹Y3mIf\ueargse=0.8575;򲗲/_^9886,ercept2515T@ eeHXtifi12reiff@typ9bst,9stlonnotobI 3roHcaeryow f8I(honڐrzeroԈ/J%+, WǏǁ„ЁphɈB)c'h襠ThL0pot1̄˃Hfmis ]J oncl on:B&vewd1pЭy8cau @؁Ăoutprequi 1`LͶ culaϴ㉰҃LcusУGloymAlabo@or $abil9肖sY诈odinɿ|bQ’:X,uidihcirapyA-28hg`__TurbricmunoassayX0IgMIκ `)qufZ0!Xڌn@nocxgammohxu>N..oie10u>*Alvi,ЁShowR.radς S Harll>
. 1Theindingiterouptd.,IRMINGHAM,ndˁHdom,>2Divisionfmmuyndnfect,ԄMedicalchoolversqBirmPhaP7769br)MccurapquantifPфgMonoclonproteinsyerumlxrophoresis (SPE)aneamperPitsailureoigfromPorig!Yheavily-polymeris0nat.ofix{(IFimvsen88[detutson-t8vSpec)́bodieabeenducwhichecognonformepitopspannjunKQlighthaQ+.Ȋescriautoed,urbidimetriassayXorߎMκcPnSPAbPLUSb>™,,@nch-'tervablě.ā9v/sios uaspiȆdiagnoqWUgammopath. mx racisticsummat below.AᝐHh/td /t@瀏ǂǂ>Measurrange (g/L)____Y0.2-5.018-4.5'Sda߂////)1/1ׁׁׁׁ׆c9ςOOOϼPρρρρρφ>Sτ????0.00ׁׁׁׁׁ18߆BX (s????:5___ooo>Linetg">y = 0.992x -H144/Lpp>/.960838777773Intra-Sprecis!%CV/.8% (4.13O 7 1?7?(meanonceQq)/450h0 2.0?7?=n=84焜43 297er/???焜3>3>2.1% (0.29)

TotalOOOOO3O 0O7O獫OO.8O7O6DOdž/table>PLUSA-29g_XElevCA-125,FPβ-hCGAMildSevPreeclsia7774u>P.yaw,.hp,..adav,̀hha,ʁ)a. InstituMc8,UTH,mu,ep(CEAAlpha-fepP(PBetau0horGdotr (sxlXX,h8mourrkerxihPtim`frokia.GM"s:{ospiyb`s-sq@duc჊M2009Augustx10. 60agnot 4AruحzP$./w defPTA`ralanoCHensust8m9+iapaewthrtf208ekzgjur-ardioif_y;TЄքdzRcrAфoau(1)ystol(ȱpy ≥1mmg؁L1Ճa(2)OH>5m24urs. 17DfillvgggAgendestationaleriodatchedregnantontrolsereelected.5lflowasrawnnd(rumseparaithin 1oursamplel orhesti8@CEA,A125,FP β-hCGsinghemiluminesceAssay (BeijBio-ekhHtechnology).annhitney-Uusmcomiskmedianetween tworoups.OCurve (ReceiverϊȆhHCh`ptic)bplot}opIlt-offummarkerhich uld䂹nguishiecl8siaromeims.
A-30 @g`__K-ras/BRAFuslctie:ltiplexe@biochiprrAaju,ȉPu!,̀rCrockard, J.֛Yt,Ӟ(itzgld. Rox@boorHXrumlin,niKdom/i0BackAnd؈Wc (CRC)s⡰rd8l`aneoplasmorid`sedar!useX)W0erX"is჻urableh8fi(eardrapeuag*epꇘwfacȧcepI(EGFR)avemHvout0)pȂҐadvad/ޅPeYaubseb}jnPIknowrup녁)hwaȇqi-Qap!/ypf30-40Thu uanlpdict ichwill(iȇWQassocЋhdd؄R12-ho i0o"yXtreatm8OeH:ԁ8Џretxo0!axy0ymllowѢ煘{~.hpBer1ahqsiYaussgfrequjdQ12"13 600ethq:NA+190o l9s<ȉ ዠXb`s9beybri,igT-pair0pljI'Ҏ((nsspecYAfi#.ƒs@yPҩ(s8cr@Ѝ(DTRs)h@ghaaptu,Ȝ 8iɆ d-typcCheunqXd@)ganalysisithhevidencenvestigatornalyser.
A-31g`__Developنuex®icrosp-B:A YIQuXMHuHDhCG@βSerumu>S.linton /b/u>,.­artins''$2''G@a/. UnrUtahchoolyMediceАPath8gy,altake ,T,1ARUPɪitu0ɪ(HEx@i)'''"NBackgr:x Hum0r0gdotropH()aPlycoprotenoval0ssoHalphaBbetub@ Sse8\placcsyncy8hoblasdurqhgna.J8ducksom8alijixsuX(tqgPelus,mȅLnfree׆Љβ).XS0e7AvesqtPtoI hv@WWXfIvari`objY]study0dۄH.Ćbpψ@, ls1.hdsTwonoclbod!!;xwu2teìL@>AAry׃նepitȐ's8dphxerythh.HOe귰Reag҆,UHk)n),CWWn)2!InnndardKn' Plनz (LHfollic P8 (FS!thyroid?? (T8omd8 bupH 7.4)ta1%vRxb1.Ƈ(Ha, 100 μLam` A20%i-sQincubb3&? ؃؂fh0߲E-reporAadd߂iك9,m`fluoen)qdsaF`tP/ss:aK)rangߘ1-78012-3,00pmol/L,Лily.hereasoecognitionfCGyhenti-βabeledicrospheres.ԁ/Gsemonstrat0.5%s-reactivityithβ.nalyticalpecificPassed酙veryxperimentpFor,interfnceromR (≤100U/L),HFS5%rԀ퀳but111-12`inp -and 25,0pmolZng@tes' iwobservn (137-257%t0`L)'ߊ77777777?,GGɅ, 2,,produchanCϊ12, 149302%,IXelyZ45-1,07DŽ
A-32g`__Rxdefyularatrix2arl*ur`suPȅdy蓈߃߃߃u>A.śTANCIU1,.LUCKP.EAGOEͅǁ3IINESCׁIntutOncyuch@st,_,ҙnia,1C8PUr5ury,đ RlranIPeniÛWWWWWiiWWUnr`y ”Poehpg_mBackgr:in71yxi8dishowZKh,xt(ȥ0oZ(gssnvaj%Reg follow-upp0thP.͠Sopr膘 (MMPs)RimpohmedXtPon.lsoea󂹁Bir-inhibi(TI⅀0ȵNrJ*s)earup!,qfavg|,xsakwths.ԇstudyimol)חsignP-2@89,ԈH-2}/$tiio*IdeteǓԕ(uhgww{Ms:eؙb>0l Ȃɂrom 75w(59les, 16eb)k (pTaT1), u8montȀthecyt!Ϛ(ߋ(asu*sameo؇plpbirstQ@thr$(TURBXeach?stoscopyÃhmXasp bna 0imއ-9byLISXWpompHSsK5atAericNcQ8rpse.Çdo@8Ȅ f0ndarSthedentificationfladderancer.heiopsyanyuspiciouseswaserformedorhistopatologlxaminR.
A-33g`__ExploXostudy"rehn-geneeqIpDNAromFPE tissuفAKRAS,GFRjBRAF炐utฉlab otypsays///,u>J..Î(an<>1,.oss2D.ipsoׁׁ,.el(ky.arosz牁Parker.heeƅuhׁ׃ׁ,.wirko.“xnTloom߁߁߁߁.ĠCro. Fo)MepinCambridgXMA,DextmePa"LOAlban0Colle),YhqBackInd:Χ GS(NGS)@dc,lgh(st㱪tGShxpp sexisJSang8esHاrmX?Rnetn".ɳsestaᄘvge30-40-foltargetsufsqityemspi(50%lxI).Ɔsom@cell (j)Jmu bAcheper,ord100s,9provide >99%go min1𻹅s<.ȏeporn(еan_įaz-basXanalys189 r-readp834harmacoRԏdard'1ignpG.Me`ds:peciAelyixe@@aHn-embedd`surgconeedbiopsie-aspiHPvpQtissuype.a(pamphadenreviouslyestedorRAS,GFRrRAFutationyclinicaleferenceaboratory.NAxtracromighty-fivepecimenssingolumn-basmethodasasthroughoXessayrocess.hossible 200gfachampqubopnstructsequ9libraTargeрes (3,230nd 37ntryP223enes)ihybrid-seleCpublishS-dnIlhinaiSeqx0latm.aalls|wnewdesignautomaanalysiipe`ezaayaXp!eOfileNGSHsultdZzgreeptitheviourepory.
A-34g`__Pep뽢2(omizpara`erӔ@0Ȓpet𜟿mur1HЁcti (PSA)1hum@sma. Vt0der"="tophtr8__]u>SPrushin<><ll>1,œ.lee,..o)̓.oodso,..Ӎ8h̊n2G߁߁ MayoÝZpgeMeochperN,_____PzrHInse,,agton,C,"NBackund:Ș`muno⬐u0,u9difXg᷈rel򪑜body6ٲ+]$Ȣrump >F ,cH*a0ysiithmumbdlevel掘 1.2mol9LSE)2HSQ).Ň'ćGErhumanlasmaas*ge 98-99% highZ90%s"rÍ73awz. ConclusX:zWqthstegydQopmaa_Pfnc@ethonrlookseasi.Ԃutilitʃr2harmonizIexi8H"JwaitxurȨrxs? 1A-35gO_ZBiomarkDisco{EarlyIJHepatocellularanihnfPІ0gggcu>G.̀ufa1,..вAsen////. Hyunsu.icae.nyder2Clinkׁ. UnisTex0Med1ranch ,Ga@ston,ǀ_TX,σσχiσρKelseyeyboldþic.,oLackground:c(HCC)s2mostomypeQpriyc8ansixaga us deaworld8projri8ȄnewCCsesUSduain`toȊ hoirusyVxʞp.generPpopJwS nseomsdecad`af@hhlo@gnos`TPiZeIdiaHatɭagqkRuccessfulrapecv(Ydifficult,fotmpos|Lrta?Rbyb{,@s,/spl8.lugXlpha-Ferot (AFP`hehسCscreen@ЅІr(dтperDJ.ϲRf@d8 a;areri@ccu,penspp ange o aXptspecihacilwou0vPgnaAc҈bPfitethods:nhistudywoistinctroteomicsethodologieseresedo1filenddentifyЀPalerumaqbiomarkerxuitabforarlyCCetection.llati@shoosenHCVNA sitiveutfreefo-infCithIVHBV,Ja0orylowlcoholnsumpnegngwfoundcovariantiskacs.h!Catusn?waserifipcally,adFP>400g/mL,ritASLDadiographicrit`atprefrx(ІPstrategyaHptamer-ˋhnay (Bio-Rad)u(;comsspe>dyna0ngeofxlexit'pe`domeÅׅЃȁ+furresolv؆[2D-DIGEfluocxig0ux㇀HTypnriomager.recancero(H)ʀC)LٓDeCydHɐq؂pˆ0'sel@}analysialinv؉i8latm!obmoularHight (LMW)׍ (<20kDausp38harborabolsde0dpducȈ8,@l0y18isotop0abeluȥMSܩ/3iquea`edividuxsaaa 4ďm/zi..ơ(,8𘧘>O7󩘑tryc@gelznnanoIMS/(de(mpab`obta؝Xirmjoncl0ontwooie oya0W흈i diПiomarkerؖjbishretweeyAwiXbevaluAiracႰshear񉠚8risk.A-3bxg`__OuabTargeXUldPponx9hkzepG2elpduGlucoDeprivoookT.zir,.a@V.i@c,.lacam,.alis,.uzgun,.ǏeXBedir. Ondokuzayı9(rsȁamsTudh P耢 occuثumoqa ꔹu5(UPR). 2-deoxyg(2-DGypoglyca-mhckag0,syn )ogEinhibiAolyblocksˈ0wthADGsoHjsyoreby)EɀxqERucـxLio*pecqՖȂNa +>/K-ATP`.eviAstudY bsoɅopoptohum@lQP`#.Ɂhd]o@AJRhip铀not0knBrew0bHeffЅXlife"X7 HH+X\|mh؁ɱ(n!Cgramﵠdea`霉Methods,curon96-wyplates (5 x 103 >OatldidotausytotoxicwhhhyverffeendsHsdi,svidysisaselric8impedasigH.k7,zhaHɊ(uc@nhem0tisuggedown-regul2Jompat?n_ZwwDgluco depriv.ltHgh,aloPinhzn,aradA y,thZ؍-GAr,re88sz'ojIn0H"b,Fdecioy*!ȋoppj"Jupxse-Xent8Aȁё)qnourDžDžˆPsibjapoptoPshowh`߃٨inhibiqRNAplhngÓ(luJ(ralaypbUPRTr9 A# cane>/`Our؉kdisrup9durycoulha0oachs򀹆Y*killA2 )dop-targe*druags@u˫م dj@tonvh0Hԓ)ap)warxvigorig

A-37gb__QFeyImmunBloodԄs:rospDCbisSifCPrׄׄׄu>D..eier,ӛPurPN.ˀyhr(AjSaengȀAhlqu@Ja,€jKa. MayoÐic$ MN,HiBackgnd:bQ (FITs)detcc⊺sto̖lct(CRC)en ֋PefITavailablhommerciAhisliabi؍{gram\^𜱥nh}q!l1wē3data721Peetrickq_[^Hhods/bj:oMHa`s1`alyt ꀸ/yډxM::Polymedcod`CortltanoyY)@0 th8studѰjs-automڅOOC-MicroiL.ƃ(,RS(xmanufxurer-ܢCȚ (in-sn-ayؑBikBsampl@>.̺0@Dhook-eؚPYiut@z@vςω8xdiluIneQpohtǁaЮrefri8tempYp 10tƒtwxi0rhnpgsȺx(2su턈s|8hgg, 723ymH8ic̓etwag45-85[aormpnosco0Z3@søsed.ŧip闬aQ"fromhi1boب#evaluaccorso’stru@Dxoglobhch8gЈ 100g/mLDAvcut-offƪVpProntitativeIT,ndisibleyonheeadingtripaseemedosi forRqualT (manufacturerslaidetectilimit = 50g/mLb).
>PrecofntTithCaterial (n(20)roduc 100%oncordanceneg[xinXpre1ons.pikfecsamples22.4%, 21.1%17.6%VsteanentrɄh,H63937themoglobin,0spvely.ԇcutoffgZ@challeng4/ (20/2Y), 4(17)6mT=.inearity&d n؍veSra46o19(yq.75x +45; @r2hClon:ТŇalytC(@ccby' OC-Micro)CsojLt)ado70potȦɈ(yiemals+?esuЯQ)CRCcreen`.F.ǯahбu>,.aird.9Un`rPjWashtSeattlpWA,i𓮀L@ckgroundWhiHphologexamiؠɣai@pnppHtdiai1r0ti@bg9u%of(5pddoain@nolH81al(q38#tesur@e (i.HER2)eucleieؐ98ceptor)ccell*hviv)etů9apAtudYhahownrhg`frequImolecularisssz"WcmeHdimLY៸nee.olXf(iGa❪ap`acȑX תJWWRwxh'ȋSիrel ithXtocheGẁ2طb0sh/Xz{exrJ3x10μMxirupJommeK*4buA.vNovaa>A-39gc__InILICOuantitvevaluXonBiomarkersqearlyetec5PancrecÀXeru>D.Ž,.han,.ڀHg. Johnsopkins,xltimorMD, ȆX5Mkground:cCȎeostad s5-yXurviatabout 5%. spi9usf≵didsportinl؂uaonCA19-9JlЁPbyRFDAc8icXuse.ɂ9hstudy,eanee`sqerAia"`hfurRЙ͛spUBMEDataahch9arlxerms “eoplasmPANINȁadenocpin”,bd)roteompOnsiityyfoldIJjexPc3@psH opulcch`riccellne`asstypϐ@sp@ficj0adROC`Ang`@mRNA.хXscorisystemd' ,uHfi*HcohokʕrankߪG>esult@Wpiligύzov8xntrro550Ok!2309iqIs1716Tseig0jopZ8lotacЃiag0xpsA?xhOpublqs (left) Sper˜H ()ƔSiaggreg1_zcirPi@) (r)mHeop-how?(26)fd8020y (74% (86%{15Ä_\7.7y3.3682'185)cx?oRGCO,7177775qi t0p(CA 242,100p,EACAM1C6ICXMUC5ACA4,PS,SCAVEGFAXsϻhep OxSuti(yꂹxdP0QOK. a>A-41ȁgc__AssmpxELISAChogЍASerumbXzH-DoHookffiO شϊ:CgAmmunoRsu>J.rickson/b/u>,.ǀrene//,2//>؁ARUP (tuʨEx(i PathologSaltakeë"UT,?????UnryUtahchoolyMedn8De teggg j WBackground: (p 49ilodx 5setoryuneuroendocrellfunhho)amhijipeptPateinXsri$XWvasos驠II,Ac9ap4!hy.ԇc80|ul9gh ede sQbseful6ɁiNJtumorDu лi8humhpqa¡(Alpcoiagnich em,HAxnt,-dkwo'kxim8P15%!xs.his wasnexpectedivenheequentialormatfassay.eyposizthaeptide(s)erpdromgApresၑhighoncration"ponsible pparhookffuthsternlotnvxigbserelus.ȀwescribenalyticperhararicsZCisBiohoa™ELISA (USnc.,edhd,A)ealidaXotdreplacem1AlpcoOfarXularЇp,an1ess’0bilityolimin@RpropXicct.
thrߗߗ2ח׀0i>=0.997Xin-runiCV 6.8, 2.85.9%AGB832, 93529c,‘ve(n=().tweej8.6,0׃47, 33(663OOI15OO&mbiemaZainim1wo (0quotss`t 0, 124"488ur62±1.557±5.3094.7S)Ӆ4-8 °C14Є1[̄0y46ف386±22.6.npyۃȚ /W//_/(ok95Enognifdipsd9fi; d(p@49\BПssl@tXbuage (___08ha0024): 8რi&?蚘show{GGG`lizmAlpcoLISAdxtphib(phenoPwXTCisBi$Êl0:DCh0oaem(bc꿔aquifyɁinu݆ȐQz ob/텭.A-4 bg`__AutoboS`Jxsiomark DiXnguishro@C!rBen(HyHplasiaPElevSP҅u>D..'Rke??<1??0u>,Ģ.Johnson77776,҄:Caiazzoo.el3B.ReepUr߁ρρρ,.ЋLearyRichiS.iu. HiXבi>Bram:W'sospit؀NorxasnnivityxonA,Inano,nc.es chriangleark,C,

A-43g`__tec¹EarlyĞȅO#Çg0a8 ǃǃu>M..arzinke,ٜ,.יXhaZHg. Joh8Hopki@Medl0tuBaltim,D, 0'oBackgrA:00b>carhxh(0metayPe򜨀ЧɪHdpr@`g͉_,ԁqoival聸d:moleculaˆphologymxun1rXwفmsikdYbo@diaxur@studHpo@thworkћanalyzptempornrzwi=ouldyus׋$Ӕo{ʄy,lѻcellt؎:m8oo虱2/׌׆3ocx wl9liȆ8rboЈche!-thghpuths@ry/Č*spMethods֎9humH@ousVCAR-39origipr0!m©scita};uno6HEGFinhibY2902"1248 ssד,mmunoblotAkt-s ry(qpermed.Ɓ8p0otypixMTTGCyhTryp pe8d +yss/ރiTRAQ-labxquAqvLqy2D-LC-MALDI-TOF/ ESI-LTQ-OrbPT7R6upregɄ\se()112h (Fi@A)bpSd48B)Q@m֏vab8shww-Ќ'didothowpcreases inroliferationt 12hndernyreatmentondi*(Fig.)owever,TTntensityhd 1.7-foldc@seHbactivY48hGF-Rcells;hereas@23de7esencefY294002tD,<0.01spmparxtoehicle).ubsequxly,RulaIdtoryxAs0filesianalyzbyC-MS/MSassitePcxid`sAovariachyper(.
>ThatamonsthXoposOVCAR-3odelube(mu(biochemical/o`hangxime.iomarkerssociwithtempora`mayvaluableo`earlyteHgp~10pta0>-44oggXRCC1 399rg>Gl28152GyA)P(correliri Qu ducradioap‰st&`su>A.ǘofronescu,..arshall,.hu. Medni(J0SouxCana,hheston,C, NBackgro0FItss$)200,8ew(PCa)hXiagnU.S.a2010rapxb48%akДAe@omm|irPHX._Wlopdeapeuteffs (AREs)0uch9lrrcxrri,tHysfun:,rtHpng,lhn.Ƃowvaveotenllfd,thoughgene9non-jHdBimplX.-rrepac+le 1 ()Ienzyminvol9@DNA|.vioutudy P@Pooojh׈Ӹdisk-ՠHj⁙xQ@objI`thsHidQfypX`؄betwwwwr/$(QoL)u`osymptomaߥߗehds:cohortq67*ƚʋ5wo(r) yhl8IߊʆHGGBsg8McoshwsЛPomd+!Am@թogA: 0, h`; 1,lz; 2,@sts`sfi3ixQ4dis 5nhy; 6, .t:Xs0r a(ifC’sLChPeq0Ixbutxaف4fʍ_PpQoopa 1zAsoomПHtyp}mTaqM SNPyp(Ap88Biosystems)zZnalyztwo-dis،extxCdireOxigniffp! < 0.05_esultXI2@%, 41cwild- (GG26ۯP(GA +hGGGA(:rx؃_ Z0.60.4p[ly oupnpIO//*soz,h8haoL@(GG%02*307,8Wl͒ΐ܃(p =016)oncl >Ourataugghܒgg5aHxngg''N׶pr(Qmx-{urzaaneeP(cov‡ieˌnon-factorshatressociateditheiskfeteriorationnoL8ducpbyadiorapyPCahents.

A-45gb__PepsinogenndI:pplics GastricancerЄdndergoingurgeryZ.u1T.U߁߁2߁߀0uQanǁ. RuijPHospital,hanghaiiaotoUniversityedlchoooihhinaWWVWWScifhAffairs,bbottiagnsotics`vis br)MBackgro:cisne:mostreval`align0iejNor0sia.opul[screHugerumiomarkWUamprovЃearlihdiosJapanSou`KoreWhileern˂aevelyowdePstchcompartoggeclinayps (PGs)inotp؇H}ib@for(`ures.`thods؃121g e cecuLenrollfromeptemb2009Ptilnuary10re-Zp- (y7ayx)Gzmdmer laxXArchitect0SR ( ,SA).0samplʍequnuJ tch8?>Poscopheck-up,howispЂ lthy[us0ʎnor`tPғY ohY59.7@(re: 85,0n 63),r\ڝe/62eQ.lasholocl`WXajorIHaocaPn55%آlymphʂexclud5Psxudy.NMXag9bdhexplor;uvмo0`erim( trecorexit73ttHI1ap`Result PGPhJ?(82s 64g/mL,=0.04@wR/h^whPtum aiP 5cm1 (4.53.7΋diff!Ʌsqc(xtijm0erm!(50e*abЅùeϏxbtypdeg1ij,vasnesnvolveڅ(dC7o%hȌҎ55ұ*AUC 0.645 (95%I:x572-0.718)´Uɝ!;12.677y835)lR@CA724 ?;V.ϽPhitw)thgϡ֖Iexrops𠳐>hgnxɟmt:p<1,e-wayNOVaEHt-fivivQXt 6nth1earW!favSga9x(PCpl:H2ioADalu0t#qFipag׾Ӑ8.̅QQA-46gb__DsPuaYsHE4BEp`eli(OvCꃿu>C.Ʃxér<>1,.ellman,Á耀ׁׁׁׁ.ar2
,.ilsson<1. 2OOJ77snc,alverPA br)Mackground:urvivalfvarianancersighlyepentpontagediseasetXJandhereforeSY!needimprov`methodsorartection.umepididymHtein 4 (HE4)0rexpressxWrcinomaeSserumithjnsitivityspecific(CRes. 2003; 63:3695-700)ellstromtlecreporɅoaainearkneoplasmsrett2010;296:43-8)7y)tcompar0I5.ehtudywmubh܉)sample8EOCati@nRbenignPinve@gatxflevelshoH`vettHer8cȅ:.ETHODS:xЄȁial:Ճʁw1analyz(aQ@b449ubjdpelv(ses: 137HXI`lowlapntumor30I/II, 74}IV, 21MP12nd)3nynecologic$.ԊclinX9KccordingaguideP byIn0no ƧrjGnR`FIGO`XAȁȡTcϔ̇"EIA//,1.cre n8,Ʌnl(a,WQvia8lorirrmiJaffeXa[RESULTS:ً,1Patce (ROC)ʝlVxanȗnt HdemonၸpxAU0.86 (95%I =y2-0.90|me0naluH o-Max/Min: 28.2/0.(:.2 142.1hxA-47g`__70AccuPSA,Xfifth-gen]digitimmunoass1xtH@tiȄwwwtu>D..ilsou>,.rovuncP,āanlon,̙8(gRSoIPhl,.ОQ`J.ҐX,.aT b Four`Piech,€Qnk,ivnaXK.inneȀjGurkiXRiss\DuffQuxorpo8ambridgxMTMMethod:ewedevelopedaramagneead-bdLI !u(high-dy SingleqMoqlecuAyrr0 (SiMo>).nd dua@-captP-acomplexendocinzymeabelxbeta-galactosidp)singulYmicroa[ɖbro$x_elIlcain蔡vesubs PmosxfluscAproduct,hichx@hɆ)†[wolume.hXmi@1@)׀Єw(2aCDm0inic redictitaxBwi(2A-48Ёg`__SR RNAerpYaImarkpbladd`c!r7774u>K.akaXi__\1__0u>,.ӂmotoo,˄(ׁׁׁׁׁYd,.iseׁׁ3ׇׁtugimʇpishiok,ԉaborWׁ. MienryraduSchahMAsu,iPJax,ǃǃLJQǃǁHospi3Yamamotoeneralospital,uwana,ie,apan, igho9firmQ߄߂oh/oSfiÍ_Y)signc0hhaoU (p=0.001) hologlagjb>_ `pT//p(d[pTapT10<J,,splyGrade3$GOr1Y2͈3 sensiit@AUC7i83.3%, 86.1%0.898oncl`onߢaggc(non-invasBxamhZre`Ȩ/Ywri襨oTarcinomau.

A-53`g`__Relshipxtw%`ete-]ti (%fPSA)4`nhiopsq???G.obreglio,Ö@abrieli. A.O. "Car8anico",rshIȾcnbȤGGD2moj$ablggvsshichrequipmpteatm0r8ieillhoppojlbabil)˒ ၎!ur on;i S>choicF,wؖHneed`urXrudiesbj[:ovaluorrD(o}ɉ}Gr!wpPds:didX}3s176퐹me ±D: 68Q16ears0hoadngo@aDŽfЀ-[sޅdigiq97n,3bopvailJAc8njserumꂢPaemiluesAicro0ticimmunoPP(Abtiagnics`vi)k_dedefЋsl؏s`HRˑ בQwэ1g/ml18.73;O  830" y: 47%lrQjXobv[pA-54_^G oocylikelfPumHheoblast؁쟈,uH-(u>C.iu1,.aHuashanospital,Ӏxghaiedicalollege,udPUniversityg,hina,WWWWW@ldren'sJiaoong777:br)Mackground:um`hepatomaellin0HuH6sproducestradioxbutheecismemainsargelynknown.Methods:oristudereultured0inuousf2-6ekHih(sub|ott(uXfluenandigh3denes0InpecificEQditionsdgeneratspanediscAͅ ucleus-to-cytopla a,hmi0qprimordigermT(PGCs)norphology.Qpopul9nfa-lik(alkaIhhatase (AP)o,express8Oct4@t8ar,asa*DAZLi,9serOt9gla\Jr"sxmbl8st*sund((3( (Figy3A)?8earovarihfXissriٙhns.ԂȄӃU aggreg,hassurډ n!ichLjna7.adSooemam@/-granulo0cw0)op顩syn0١ljchd`Qxst~im7hc{zfuaHvȂ9.$keyvolvÅoioehluҙ0roid9acuteYِ`qoryte(StARa0pP450 17α-hydroxye-u17/20yI=CYP@eariPdetectaOr r,Rdiffin>3couldhowpb60 μm…p`Ӎ@oatZYYzucidahmmuno0tochem:sYa)ir I#߄@a)ag8okywshowWynapton1mplex.3 (SCP3),suggkYXerme8i`qqRT-PCR(remarkerߖۋyjZPcfP1,(2莠(*,XfH(GDF9iZîi1R!bߖߖߖCplu: pi𺇧/ucڏO!ebym*uyaplrodyiPyr蒐du Ɵ#mospneouse_XhumhheobtW,h6 7a!!siktwetu03ɂAonKfngsjxvidewpsigh Z9logy,0agnarapy.

A-55ȁg`__S 1chpcYzv oшPpPSAh󢐵fluid u>S.ac1
. 񢁁ׁ׀Scipactd,ityrUniKdom776ȃ77@vHityWsp,ondon____]3@up>Netriatd,ittingbourne,nitedˀdom, >Prostatepecificntigen (PSA)asexusforheiagnosisfcancerCa)8dooratientesponseoreatmmanyears.SAslhainlycoptehwithne-linksylPonЄonbuQpximXly 8%imoleculareight.Ԁdyk3pyWccursnhalfюerum'醠nge‚havefYQaccomp botumPyaggsicl(`iX thmay,readnleBpEityьQtes .Fϋinqb8(cHpoyRss[benignmPhyperplas(BPH)xhibitP`levelreA8ab𕙆]isozȁP hhelphruishPHrom(imzcPsen$t.view]worksshowіsideramPacadem!ntstsomqdthatC&xlmeasu UMethoAl]w؋As@nxflui0cquirmultipЈ ouIvchHatographtechnique Pplfurqhfi00exa:rfcat ((ova (llowa]Hms&wass`;aIl!yorIEF2Dctrophxwӥsam81ϜϜϜʅ ӌaffp(,paryXRqbnlexuaeus (UEA-1:gα1,2찳fupe)ϊzȇ,lidzenzyme=immuhorb8(ELLA)R %B-K:??JB̍Kfd첂rꀑtwo-(W>esxs:Bؒ@X;iPԁhreAjpXaWekƁ'oQvP`b7ubjЉlɂu06ȇ߇߇؍Ara@rizstudXIextz3oifi؆utfonclon:ѾtAv¾ラk?sourT1䐚@8rd[ubse0iPg̥SkiHatyPmarkerp/p>A-56gb__Qu {sznarl!ih71m@imyel :ςzwwwtu>S.laeyns1,.eoy2V.runel.uildGodin߁߅߁avoinneρ. Medlioch8stry-Unrpyospital,pr,ANephrolog???>AEBackgrd:
nutipleyeloma (MM)reeighthains (FLC)renvolvedHheathogenesisfenalailure,ajorausemorbi-0tality.inceversibiGDten(nechixdtimdiagno ,arlyuantificationontributesoppropriatep)ntndnag7e.th@study,eavempdPfirs,ooCymmunonephelemetryЀcthorڋxserumhurinҌ,isithMцpsrrelap8fromhmiss.
. h>iexYtoH (Klus)cr{Xa0excre݊.Őga,ssodidodecylulfH-agaro(gel74(HydrlroteinaSebiaOMttBb-mercaptoanodepolyiz .ԇ+(qWn,=20hs xxdPitL/-aac傳tid(a77Q\,spivXii-classr!"coefI (ICC)cBlx-AltsɇrSp'@ank"permede@t>"btetwexGF9dpo0reduceюvalu(r =0.11, 95%I - 0.31_0.53ہρρ06ρ2033ڊ7oignag蟀t֋P2'_Xs: 5.1/24脦1oo 4.01.8톉l9@aBA߅߅whQo;`mHhd (y = 1.40x(1704耐0.95568259/)*u_up9-:11-folderς,g'F;n__yo 7Oe) G.@anwhilis'q磵albumin,ЄHshowoodzۗޡõ胈/Cstudy꤉vmχhYɅ0bo},f߰MMtsA-57g`__RolSUricciCarcinBtLibyP ///,u>J..e1,ӕhaki2A.ar.x(߁O.lsaiet 3Hlwaamȃهp>. DetBioch,FacXBMedi(e,GPoun UnXrsH,enghazi,Arabhmahiriya,>2Facultyfedicine,irteniversity,ibyanrabamahiriya, 3DepartmeSurgery,GaryounisBenghaziׄׄԃbr)Mackgrd:ar0omaBreastsnetheostommon`icalroblemsn+speci(yeebjects.16y650meH37䁂idٗ 7thgg>ctobXhospi (2009J2010).43lthy8nt'pc205lso.uc rNj, 83fbAn17؀airtȎzgS72epm Ȋnaf o0ht擙Jbiochem*tZperformusaunes U?9Ϡ ifntrad (p = 0.0270)ǗUd<wapxd.Ɍ[j&wpebvincɀbno9E599).ׅ(G†.betw, hw ra`rar("321) ?onclon:qCe'#gXsuggade08amin a9a_xhQoxidGty.owad"ϐ,Gw6ThɌourtpo扗08inbȜ`stHWtus.A-59`g`__NInvas)To9Use)C8learDMarkeHCCu>n..巁aly.QodHBilharzYchhtute,airo,gypBacknd:xvgXcot yChPogin-A (Cg-A)prȌinduc yHx(xtagonist-b(PIVKA-II),ږ-,Pn-(m.PਐssnsiG ,FP" 1f4socellularO (@m mprUlxr.lelyQpngdyieldaccuracyx 50%68et lesA(1mime܂urgelik@rM" +HtP`s n twoatdMH logGro@e8DrtQ,qggge (TBRI)pvid:Aps 40G2HCV32π̐add`Jraphealthua0Ė!e0inalsubj0`tory;lc`ex*xbdoqlltrasonph(CT,un,Bsg@CV-AbrKbiopsxurrOJ(doRIA ELISha`per`mK8.ؑOخȀihpL񃨆q߃ػ8bXLGo.P<0.0018u{cirrhoYۂ ԏ Ίp҃rr`BbiliruV瑰r=421 < 0.02,ndnCCp.= 0.450P<01.lsothowsegativeorrel`onitherumlbumlevel-0.399aosiςofoignificant_mFP?bogroups.hile4PIVKA-II\r0aledhighlyσφA-60gb__U HE4CA 125Bio EpelpvariCancerOOOLu>Z.i1,.adwan,.ushnHHarleyӅjuׁׁׁׁ.al@eжex`G.ickԋ`ettlet2Moh߁߁2߁߅Barnes烿. Fujirebios8c.alhnA,'''''Wo{nf0sosHal,rownn0yProvМhbr`)MPckground:HJˆ/rԥЍHur2ulzhf?9lsp(@(TayKhuaK, 1994;Ȼst,x2010)ilotudyperminve8gPo`gb1utilYňwBe(EOC).MethodσwmdSARCHITECTe(ABBOTT)EIA (ggs,j)QtX[a`IfeubjPs (N =5; 6Єa; 141sbenmsN(al7ebta8yȇ_didyg/dL@ntr&crenX.intonreview(ard-app`ank.lQi@҈bbPdn hologm05eOResultYabHNCplus(:ս߽ߋppea(ysefulϕϕϕr.Jtbor="1"gn="toptrd0lspa5wpeight="0pt"dthdDer">.НYGG@IX/td)0iGGG`>ȃ7ρρρρɘ'''''!s?ogoMen[ǂ29513mol/L39ρheight="0pt"idth="0`>6.3/mL

100.4߁߁߁߁߁2.94G.030NJWWLikelihoodatio777713.0ρρρρρˆwρρρϊL8ρρρρρ˔W|Sensitivity3%ρρρρρ8ρρρρρ0ρρρρϵ 6ω߁߀pecific߄ρρρρρρρρρρρρρρρρω߁߀}PPVρρρρ57Gρρρρ9ρρρρρˑρρρρ̉}Nρρρρ8ρρρρ̝ρρρρׁ̇ρρρρ̢g6oncordancethlinicaliagnosisςςςϘwρρρρ>7gρρρρ4ρρρρρ2ϊ/table>A-61Hh8g__Eu1nferumetallotheinevelnHentsspinocellular㍡r)headreck7774u>R.rusap/b/u>,.ajzlik ,.erH.rizkov߁,.damׁׁׁׁ.in>3Mqsarw4T.ckschlagerɏYzn5PK ߁߉߁. Facultyootolrague 5,zechepublic,oooooMendhUniversity,rno /small>Facultyospital,rno,zechepublic, 4npindingtes.he beenisco`newxIicalsthese.cluthoneededHarcinogeniccesHowe0irasedicthrkrema)crsial.ӁeportsldTx@ssȂognostfactor tumourvndrugsistance9aarie늠igniimistudytoetermmoilloodpatienPwi(@nPllmaheadJneckay@eHchemhods./Ȁ Par؇ssampP.) keptt 99 °CB15in.,an@0d4Qcrifug(16 000g , 30)k`erXaobtmeasuE74mÁ@m747AӃЕstruiɋPt746)TraAnalyz 695utocrpehm,ӂ0l0'|lyteMCo(NHb3b>)6>]Cl7Z1mmoniumuffer;΅oooo(aq永C(pH 9.6)chanaf aD# (!Hۂfows:XitpnR`-0.p,π1.75modt8 0.0570qinhv0.2pO 2ʅie -25Eads> = 0֠gsР`IioyioЁBrka臊߷pZجȧЌ ඨHxatZ蚸m&aѭ.capabx1yu µBEgPslrrci Xptil8á?'! 0r ܔ巰eˋT'%OJYabout (2.±32)M (n1284O8mtXsighAcomisjsXlthyolu(0.5120 5(addx!xdie0setwelois Q;bstGtX_8oropharynx (761.24,6hQ?;Hot((1. 5Ȃ&4)onclus> >A񳰋_,逐oss2hȋx(c8Yowst}romۛbtaXgaen8g 铛TworkJRe1..ˣk哈l.: XA.ì.8!>78b>,0), 4801-(701); 2.damKBE۪e17d18`1649-16a5`3Prusain炂51S6A56- 4.ʂhetrlov&chiActa45112-(96);

`>h`/uM.ask HRy(ll>
,.lavna21Atmurema.Çχχabsorb/(PACE 55000eck8ÖP,SA)uwwwwwwnm@n(wXolvPlyhmps (Moy582SAk,icplum̅Arra72x600).ɖ Ϗ( rouAAَAA 400 (Ingos)sxPriiloptim@d8X۞yزHwe77םߙ|9(firs.libr+larX)ѓ؁g)5A10xµM9984.̆XfGiׅݱ3S/NabXMϜls@eȽʈpppj/)l L瘷mIOf1A7enouggg݇^bhma (n=10)c_]125Bo0re-cul0Ht)@cin115 ± xIO (4www(WhlusPpthreeousiorapa`ЋӖdvantagdisa/́8cusGX9utilBeval0oX/soiPtumour` arkerhX1tnlud2atsnon-teaacdg1Љp"cician?>pknowledgT!workpor9bysACR 301/09/P436,GAZ 10200-3ndACRЀ/11/1068.
J.hrom. 1084, (1-2), 134-144 (5); 2.ʂ0etrlova?:Sep(ci.B2908!166-11732603.ցPupalk?:Sensors76932-95974.rizElectrophor8330820@3726-3735R9P5JAdam7i>Int:tche5x4p429-447a10)p>A-63Ќg`__A:icastrithserologicalarkeXof,cucosau>Aaleffi,.erli,.gahJRom,̀cadantC.onagurhG.ipp i>AziendaspedalinivXitaria,arm8Italy,Backround:heimQthPstudyasovaluateesult?lesforpsinogenPGI]XIGn 17G17]elicobacterylorigGbodiesHP-] (:opanel`demine@epidemiVcharisticJa?=ad`orth@ipopulation.?Methods:׊ nzedpermbyLISAchniqup(Biohit,щPkxFinlduloMi)梐arch aFebruary11 (Cut-off:GI: 40-100 μg/L;I:2.5;I/P>3;17:h0-7.:&l2U)`ata8ev!1055en[b'n 366퐈(34.7%Xge ±D: 51.0±16.3)6890n 65.3% (`8.42ᬗbclus inxthree(jclass1CI 1-@Nߟ٦p626Z(59,3%2ӆϓzы!10Z): 32h30.4 %S3-AX773 q450.2 inPd8208.5%)ȥi>prbleqespreaH??8fees/2: 15/56.7,2-33.8󟠒14-8͒0.0-moly51.80.1-75U864.,1@UYjey18/817337.9wq5.9,1.@0.6z4, 7.8-9@p1p8!2 (57.4%0 54/ژ43. 5.8/k`8Iмbq,h39.5)8.P2- aubstaДencf莩numbreated.p (y8g# /7''likXypeutoxrepolyoc0autoimmuyroidrssociOweigh؁ؕmaindexsuggAPCAؐ(ypax(ell:oiHEGDS.:fntccurr!l [>lusфthatuinvig@i.e.,coscop(aneea0confirm_zchNpVy.

A-64zga__IoglobulЅahpid,ensx!n`ofixY@fPumon*oteinsA.eeram1Jarding20uR.radw//3//Basuׁ׆ׁ. @iXׅi>aRoy(WolverhamptHospisHSrust,,niKdomH??>??!Bx@ӂǞLt@B8DextЦfɜitIdnfec,niversityfirmingham,g`Unitedˀdo
A-65gb__Ngyeas m pess91gٓד׌u>N.ʭourrier1,.harp,..radwell 2S Hard. TBiniGrouptd.,IRMINGHAM,ndˁHdom,QDivisyYnfh,ԄMSchoolBiqghaP7769br)MccueXrote1serumlxroؼ (8)bempd failHx%xmigRfȀorig؈ieavi0poXe0.ofix (+im(Asȯ쨻yغyT`iwescriauefulhvd[SisaBehrqBN™>IIalyX''?9x.ĶD^ z/[Ao5uQaidͽD.BmaircacisX summab(w:tableorder@"rgn="toptrdtd/t߂߀ggdA9 G߁߁߁ތ"߁߁߁߁߁߆?"0pt">Range (g/L)

0.20-6.4018 -5.6(r(r/*Sampleilution߂////)1/10߁߁߁߁߁߆Min.󆷆߂WWW5ρρρρρφensitivity????0.01ׁׁׁׁׁ09߆Assayimmins????C2ǁǁǁǁǁdžooowww">Linear肯y =18x -@92/L0P/a = 0.99wwwwu x13{86wwwwwww8w"rowspa3"">Intra-aprecisx %CV(meanoncei!)(=84/2.8% (4.85 4.2 27731.163.70.77ǂ7ǀ35 0ǂ7nter'⒯/7.9ǂ1DŽǂ73ǂɒDŽ/table>Ƃ775ɑfereasthin ±9when倘erilirub胸20,moglo5rhylp15FTU)0ddedoerumamplenowngMκndRs.P1XsurH1Xnor (bloodo)a;Xdi0.63 (range29-1.8"ho0.4o1794o/*f5996-2I+ksumm;correlatwellsa0th(Sieme Dadeehring);@01.Ӈrom 60FEositivepȊs8/12ˎUednᄨcasHP ctlydifi)XmXclonDtype.elu0thabsXov`rapid, thPf@quay`,sb(ab܆Cm0beseful|ꉦyammohies.1-66PpoggTRoInflXPducMucinouseoplasmiPancrXtic ocar)maWWWTu>A.ar8i,. lladin2Rezzill3M.or4Diott,M`i-LabЂGGze="2">3,.hilardi<. 0b> raducapilPyuxouseosms (IPMNs)the`ncsarecedhZ98ntHnXtec8userelow-wingumourshimayur splymopatPt0Onca 14:125-36, 2009).moلHsmaggress bei؀ᇚ,e#acHategippoQadopt`byTellscircumvpiimmudefen.Ԉinclu`alPxexpJmajor`ocom!bilـqlexHɞk9tHn@Ȏ0XpthghFـr!hw@couditber@tׄҏbig@Jim΁8sHyevaluPlxhco!9a f`(PlGF),form-habeta (TGF-α,ԀA1snecrr.1NF-R1):mxplloprotexse-2 (MMP-2):ticenoc0Hma0H2ris(n blisherumrkew8 CA 19-aMethodHAq69W(39Xle30edmeage:h.8±10.4ȟ؍jenrol: 23(3.3%)(646 (66.7̕ firwt.ϑs 10 (43.5b8typF rȤpX1x56ȁF(3loodonoAalsoieht76p=1.000膎;o 57.0h4.6k03Bspeci obt\morxa8hh 咃GB`Qat -20°CȘ.Л8߀H҂sdeȜPusmxciZavableiR&Dystem(MinnehNSAi-CV<3.9%0e7570Krrm9Ц: 0.2-26g/mL0.2v18,289-63,411749-1,96117-4nburxre,ß+lecchemJlu!s8Zo(-37ՄHResultsntwoXraesh{signif`difeeup<(T倴7(In0rNϰʕ7Xhig boК th@%subj0Y4;773%1#*@,ĆUOOOOiga׃ש seׅ44sm houliЙa123,688lfouXhon47dx9PseH8@2ЈDggg172±2؄(±SD gfrom3` 1,151r.ithinheroupfatientsithpncrecdenocarcinomas,WRmetasesaderumoncrPonsTNF-R1ignificantlyigher@aioseout (p=0.034).Â`lusI.ӂlwaslevatednτIPMNsnڂ߆߆uggestingpoptobctivityqbo@҆studied.


,..hua,.umpaico 2LЁ3臹e4J..am5煳Ochiai6狃WilakSubathr8Bchodi9SickW煻Hebbar. gieneralospitalࠠre_XWWWWWAsia-PacӡyǬnϞCŸMan0,ilippine'''P'''''''%Ho(K(phinpp TaipeiBwaniSeouKRepublofWWWiWWWWWWWNokyo0aȃiB@kok0hndiJohBarulay8///i//)btiagnoscagILȁbrx)Mntroduction:umhepididymisrotein 4 () beeneted8pdete72(Hellsm`Res 2003;63:3695)ndthheighes`ensitivitymQb (Mo.ynecoln18;108:402)ppretsadnexmas`9gotormfatSbenignrlPant.Objve:paucofatanhnurevaluauseyCA-125dinguisgmf`hntiLJdžret0s: 392ompelvqconfirm ultrasonograph@schedul surgeryrecruiin)sb68񅨮eows.looȕdrawriPm:`aIteanalySA0FSH)9Archct(0SR (wuHologylid„baXdPview`gcoghhZst.eoudindexڏ8/eBopti ut-offoPsʆ“separ8easeOenrol304hd288҃mcy, 60!whPXlipIeaX20.9/mLƒlesC227;corXp@ᝡHIɃ 33pmol/L114.8{Gt-'ממ׋sampp!:l- 294.1SoHse,.0À;- 45.5- 74܀.ƅ 2'ROCrve@*UCT^0.72k0forE4. Inremenopausalubjects,heiagnosticerformanceftest (sensitivity -ENS,egaedicZvalueNPV)avoE469.4%, 95.3%ersusA125442.5%.owe,orpecific(SPEC)ndo(Pfabetter896.1861887438.ԇAUCrom*OCurvesCIwereoth 0.94I''$(S,PV,ˋ؂(31.8v;(84.6/8789)quiteomparable.
~TuesdPAM,ux260Q8Ȃb>PSes  10:00m12:30mha8 Elroly/Bloodas/Metabol@sOW>A-69g_nzymcÊHinsshUnicelC.ENARD10u>,.alero,.r2A.ousquetׁ.e߁`ׁׁׁׁ. iiׁׁi>XxHospitallat,r,9灘-de-Grâ0PO:0pohstudya0o aXy?^Beckulemed{asuf㛯x gdclc8chemrnalyzer/̈́ologye(CR-Eent)tilsmi-`ppproachPdahottrЀ-poi`onamidohyda`(ހp)ѳdAconvert獐se TfurrrokdowrougIs _=ss ,osBxyd)YPoxiz8yieldcrchmo(ɀt 560m3lHt8eB(ID-GC/Ϳpyd@quirtwoevel8ibrat Eeh Ռs}_Res s?g`gaer@ccor:FrenSocietXfC’s (SFBC)r"preci BiHuPg 4)um1pool?dPc0.25,060, 1.02, 4.31R7.65g/dL.Ɗ@repab (N=20) 5.1%y9250%0.7%ȎҤplÂqain-runmς 6.0X4.402132؂OeaȚ" aHolؑ SRM914ifyxup(imitك72c틨mpكPpphmPamplshowexlrelComivailG܊oaff}sPbDpngbeargꪒsPfollow151ange=i9-17.88)`m-s_[IDMShhaz(y =3,c Ro@iagnoobInta 800.98 +H03////,[ensڃooo4_7?t8iPh ؼTx@baln,iyanidyt tXwhiؚ ar蓰ђvphenPnؐin significantnterferenceithumberfhemistryaboratoXparamesikereatinine.heesxg߂substa*asddedohhumanlasma (g = 1.38g/dL)amah4solutionsontagydroxocobalamintcentr0y103.ositiveY(+ 17%)腘beenbservfor`uppP ?;.
>Thisnzym(cessayromeckCoulHdemexcell1preci!lHaritor(UniA-70сgb__ImmunoLPhosphdylethanolŀ\Biomarkeru>P.eilsen,.zcki. EHlhscis,alt̛C,T,Hix͌ods:שpmiditXou 0Qmploy;synyl-t xd,Hewrwhich jugBP8tei1Ì`ȵbtool(?pAroi.(y (HuCAL®)AbDecnjkh@c0Xd"vdourjdar`rocedur2weeneaȶעӘoesPhCز0 mfiZ#ylrfirmkMSRNMR]R xtɋ:le-Hdexiydr (ŏ݅ko'hlipids reeւdugstw15Htr(+-ۈs[B_ёؒ28A-72Qgb__PerCharaeẁ!AssaySynchrLX®20ROUniCel®xC600/CeSymsBeckaCoeru>Laybourne,.Weese,.i@M.etzler,Оhah. ,(c,rea,A,iGObj?n肏iXd؉(LACT)(ulPoraplhlyophY@l:̂at,us8junP X(Z(؁M8ialibگAtendqu(id 0c@ɅhhuY0sma+brosp(CSF))+OZlacid-basu diagn@10tAic ology:adnzy@hjh}oxid xver0(pyruvesydroxerXNatǁă!Pmxorp??8Arpproporchangeabsorb⌰560anSg>֒`d:)H<؏^dGer+/`linear0.3-1mol/Lha!8H/a >98ȅed.׎hin-ru0ompiqaChfollows:E0(1Ine81.7t,’SD0.02%v[31mol/L;lasmaevel 2eanalueas 3.9T,hithin-runD0.056$nd:total063l a6.eCV1.0%GB4%;pin8!2.Ճt4GH4.Uu5.nterferencetudiesonducted.aximumoignificantGe (NSI = ≤p2r4.8%)": 30g/dLilirubin (unjuga), 11.2575' 50Elipemia (rapihe`ys, ascorbiccidpyruvPB40 IU8lactdehydrogenase.hthodsmparisonypormedgainstBeckmCoulyoph(z@LDassay;of7samples,angingrom4p 10.Ћ뎢ay.rrelati(aniCDxC6HobtHHXlope0.92,`cept-ȒʼnaH/coef`ieh#989SF69e.93.07n<8ll>2A-73g`__Long-mXa8(cȬHabo8oryata -erum-sodiHbPhmarku>H`.epؓ//,1//0u>,Ă öckl,ցove߁ߗ߁ԍiers߁߁܋߁Н1uck߁߁4߁߁F.oru߁߁߁,̋jThpw. LAy@CPyachPhaxceu+SciGhɛv(,lgP,777y77DehtmCͅospi////-Ȅ//GBHonolog'!Endocri'''$AcaXIAFrejB0selW ղBACKGROUNlituȃ@follow-upipvidup؅sdiansel8nʂ)קրڌwressyorks鴘lsomport epiyRsq@Ypublhealthcapoy.0we,p:shpAWexuℸtopic.ׁMwsomeas(9RtwohՈ0rQi914ars.7METHODS0m]retvpfrom-, 59߁߁߁߁>Ici؞Id`y,wever,mittinghosebtainedurweekendsndolidays.oisualizerwestheovaverage (n = 5)*link0it,hereossible,oavailaotnformation.ealculat representvetarevis (SDs)fdyercilesore1liox~168)h؁ip؀Xith0sult < 135mol/L (etmilyponatraemia)alsodjall8ta,clud''#
th-39A~4WWWWWWWWU40T.Ɩheylucturom20% (:8H~741V)'ONCLUSIONexamBum-sodiussؑQapplItG׺Әi*rac@daooil8,XɺaximX&ûs mo(nrou@2P~3/How!0.1in-subjiolog(lrGum,mayȍoighdeqInP.Ýpwpne0bixaapoȁshdfo0qnumberqYcon٧ind (iQrremprovGF il0sirlleRufur`Ixhterir-to-6,hichgqmaГ#ĴcيHes.A-74pg`__A0eQ/Nextdz~riccid9dAbbottRCHITECT JiacbSystems7774u>F... nXrHrst10u>,͂jS.гhumusOOOON,.ek؁,ҟPampsink2YPemma߁߁3߁>. xׁ׀Õ SSDZ,elfNerls,?????_`Hoofddorp''''"''''`Da@TX,lNBackg:mȢeڡ ua(UA)lsnsrelɂdxgoutrkidnstodisPYǛÛ ڞ'''y@(elopJX$noard@0!greducalibfrenc(@ rcomifPcorbkpcipxtgoxid intop11b3o5hydroе!e (H2O2ȀXcm4-aminoipyI2,4,6-tr@omo-3-xybenzo.es aseoielduinoneimineye.heesultinghangenbsorbancet 548msroportionalouriccidontra 9sample.
>ARCHITECTcarriout}݌7.asuremЏJwererformm c8000`iSystemsoeter obtaXd$,oAsubjAbe@!pf@ighosxrsup9ita.Ӎ_у.H9P3Li`dhromatograph_>҆s?Basό,im74חחא[below 3 %alleveɃa-Ividu@bi1*variability9.0`[P24.7ney meapth׀erep/y7show UA(ngen)=0.98UA-0.01,a 95%fideier@@0Qb cep 29611q5slopXp`i0ySOHaUA+3O5ȅWW 3[WWW5T5WWVUpaK!530 μm/l??pove 4mn vs A-75gb__ScannSahmet}DH8BXrubOxyhemoglo)brospll0OOOLu>N8oon< >1,.ulsipher,.ǀHache 2>. ARUPabto,altk,T,UnrsUtah ͗Background:ubarnohrrhage (SAH)saubp`aneourXileedqHspacus(lro㒢purysm.hiluzPraphy (CT)؄nRctAH98%Qpb"hs112oursIsymp،diagnosnivdecr8Ȇ50 7ayǚßYsp뙍fSF)d0ЇclinZut(ȅtifyCT-negCind dx`u0o釘ab xYۮidedoinobj[stud8(0it߃碔SFethods:absancHňeXeng`between 350J5@nmrrd(Haeckm`DU-800R*soier,bHuveta 1mh.b rawHangbegi(-3e480-52ɌKnumbun(AU)PurŃ+EZA14476asheetxyhemoglobinbsorbance (NOA)nd^biliru?A-76g`__If؝udiNextenelMagnesiAssaypUAbtRCHITECT®Systems™u>Q.u1,ʹlazar 2Y.emma߁߁߁߁ĐHrmbru`߂3I.ashim߁. UnryTexSouthweaedrCerXaTX,ǃǃljiǃǁDDiosIrvxǂǂǂÊ(ǂǂǂǂPark(p򦭦BackgrXd:ЇmaurleȩmuHinvigƁdisord@(owHa0o;molysilipemi3icPuEndogenous`mpysucslucose,9tein,corbicHiQnorgahos aPreportȅ'بurxtmerciyvail*S.rugL-DopH(knowpǂĉormin2.urrmor1effыXservHkPcollHdevicn7manol!shouldvaluaX;dߩߩytz enzym8camodhsocitXeXhydr X1<.nUabpat 340mnXduct,ADPH,i🸃(c`熠samplWindPҌׁ񀨗ts (se1)__\nrZlab3.MsoolȂsysp\variYM9substaptȆnx.Ё(trolobta@yubstitutingeionizedaterorhenpferent.agnesiumoncratseasurin 7eplicPssaabov0ssaynAbbottRCHITECT c8000 Systems.ubstajnotsiddoGferagef߁calculdHۆ<>t]/7 *1with.5nd 10%Bserurinespectively.I (h@esc.rout)XЉ׃oooob>SI[Mg]g/dLga(%b>Uq?ǃǃǃǃAscorbiccid(: 3)(:: 2sux>*p> WWWW">2.04?3.92w6.390.33G-0.2 0.083.1GOOOOOH67W1.17OwGlucose1?GGGG8G4.15w6.83O -9-3ςςςςς5.6 9GGGG44wHemoglobin' 58GG$51i?.9 7.01 O p95c1g 8.7/GGGGtoj7o7Conjugatediliru 6gĂe03.7߈1T71G0.8_p6̅gJ6OOOO[a42W7UncGF (ǏǏǏǏǏDžm &oooφ''''͝P7'7@91߁P4oo'.2 2.30 80ϓp Oo///+Intr`pid(ߌ߂0-5.35
/t8trboL-Dopa(5g/dL)y1.6 3.81w6.290.7 -1.4 93ςω_">Albumin(50#*5.69o9.91GGGG60O0.04OwInorganichos rus (278.8Lj77742j8_GGGGk42.5wwwBorPacid/(100WWWWWW??7339.0GGGGB?A1ߊ߂o6NCl(L57w10.2OOOOL7> 7.26Go<0%cetA@WgWׅׅ׈ƽǂOOOOK2''%//h4.30w?''''Nit7+gGg&5g8OOOOI6''/201''''"Sodiumlu(de(477_υώ759w8.7ǂGGGG13.36''///-6.95/table/߃nlynenterfereconc@rationasested./OO-_^S(ificahocebservedtheta`'7Àlus:ԁAbbottexteneMagnesAssaysobustgain@commHts.nddi,aofdvxag(fackA/from-Dopa.˜cndydrochlesqsuiripreQves;owever,ط,3k1sfePsaXwithH.1דb>A-77g__Dlopm!E ucaiquxChatography-M`pectetryethodorzDeminVCre`nihՊA-BaStardeMrial7774u>J..amara,..hinney. NIST,aburg,D,i>

ackground:hebjectivPfhistudysoevelopndvaluatehalyticalethodoreterminationcre`ninenumurypurpos assig`gertifiedeygaaewtardeferenceͅ0rial.ÁlYsbotherum„karmporxt0dtorskidneyailure.Ƀddi,eryowgUmayⅡ`dul@`dpecimenshenesPgdrugbu(Pertes*oftnormalizDŽYpadjustsampleolum8as.NjPIntuЋTechnology (NIST)s___l (SRM)sup1ccu@easHtFcl0community.M:s:reliexpaserpmomptwHiftm(3riYoiquidhromgraphy-mRtet(LC-MS) sidci󌸀Imi-modxexchang0olid-pha0extra(MCXPE).؛oolspikwitable-isotopHabeld3-inyXsƒH1:10 (v:v)0.01ClFHs0ix.alHIŎ{rocessus9\orig(lI1ecPt.  !{ brby) 914ag+71'f`lpuRsPrHr0yYC188nsocYcradifol3ЊHvehsprizߙܳA ۀ)j((SIMȏyZxy8(viousloyucYfulȤDߋRhonthat%di',IMLJƖ@c&݁0l`׼LC?r9cȂ9x3 eʐ3coJstudАhichnowno蔪ۉoZ dd㾴t 4ƍȯЄ" 0.604g/g-4.35R?sHDuso߀rg`cullui:larutkdispla18exa[0.5 µJ (JdL-1.0S)e,=: (A:))G6p4Rcontbőtyp&por.¦0dfbay@Ag272,ahly-run %Vs=%-0.42ot= 2%Oȓ᛬10%GonclonXuXcombidifawtlrǠױ furprm΅H777r`wiȑƑ(c s؎ap1rici "vѫ:ssigPgV-bbSt(ardce̓(P

A-78Ќg`__Re-ifugNxgi8ziȅfntin)):ǯdГ(xȇ gggdu>H.hafi,ppo@MXchmp,Ȁdrzadeh. Ce`s-SiedÆer,osh,A,ƀNBackground:Infabo(As񈸕(haeSr on(“clot”ubeXordIoetfycl!p٦.lso,a@scvdr3؆1(Riallyubesithouterum0paratingel)oaximize/plasmaecovery.ecentrifugonsoneensurPhe0andequateolumeforfXmultipleHpePdiffXntestd/hPrudialthatorddourftehigia(yswasomted.oBHtnowledgnorehiv`tudishow*impac:艟conʀshus,eecid)y"e77775glucose,odium,otassZchl0dBUNxrrinbicarbthcalchos r)gnea.
s '>erelxnary9quns照敧//+,odegree.ȄHGD,ignifXntlφ˔ fςȔWȃ(44.4 ± 13@1.68.`@niSDer!f[0z߂,t@ly<0.0001Also;/,g!熑`ט4onupC(21.72???8<05/a3777(11.36<7.9y3.32);hplyÅlusКǼNPՋո'WWWWWWTGaluX'!rebta lat1ul9caus/p>A-79Xxg`__PseudohypAremia,Ѐk؀RDueQLipohteXɅf興7774u>H..eu>,ԲivakumaSp.haidarun,.ʀomi,͠`08ki. Dartmouthdlchool &Ā-HitchcockNCpLebano`NH, 0oreʮa 61-year-ofeHIwipsyolongbXuҫpliaryǃse蜨y paX1*WR(ulpONerTL_]bjЅs:Թdyf ラ___(2鍑 ullXmethodgJ quhd’sXߥ8Qs:b>Tlpjl,ȋD8ityyHDL)adi8ṫp(Ld䅏ɷ wzxaXRe͋larrobas 6000nalyzer.othlatformstilizendirecton-selXiveIrodeechnologyorlytesis.ŀaslsoerednheapidlab 1250loodqt (Siemens),LingOONs.
AȎxg`__ISO189CCREDITATIONFOUTINENDMERGENCYIOCHEMISTRY'''$u>P.ernet,.asnier,.ario,.énéteau-Burna`F.ǑbM.aubpdolle. AP-HP,oSa-Ant e,Ђش(FcxA-81g`__Lid-blezyxassq{potiumVք S.ubbardp/a,ҙP.auf2P.Ʉa@ğoe sŷtzȅׁ, TekH. DiaS8gnosxsmbH,olzm,er`wwwwwSAyInc.illsPough,JPImȥortapelyt@huody.?ɥP@qmо+cellpr)e!ڪ cru)prtusc,9neuroun8Moorll/jnXrX8as(؀xllmerg y >outinelsHhods֠detinfaflamRs@hscopy (FES) \o1yriv+dISE)ccepxreferaiuyuowput8hPotSteg؉q?={ȃg͇"Ȃǂǂ,Bl؋ SenZreli؀IAl@Pstp"H/seem ɔunns,vر:Pw(AGЃ*hatakenksideȁrketx {thot0bviouPqs (lhk,urbid|s7lreadyʄҌ quali*ڑalwsforlle,ߪptimla(a)8 id!ER@cp|-knownotassiumependencyfyruvateinase,hichsouplediaact)dehydrogeaoheHnversionAcetyl-NADH +920㇨ic1nalyzer.ԕcXɖalculpdsaultipo؀ibcay’siBXipx< 2%Hithpprox. 3mol/Lg1ǁXup6xday-to-87%ҐwholeDinghnge1!8'&AthodmparispXFES (Ep orf,FOX 5053)howlopbb=1.046acepta=-0.16n=55גל8coefihr= 0.97 niaK1.1%ha nogni&± 4.5%@miKodybetween 100180,cor,incSrЎ{0.51Wmaghߍl,pids20mg/dbilirussbacidt3durIssthautwo-AonGȊ`"uitabphotoPrp:Zme-dboo(qبĤuPweAnoutinx5milaror8cSEZ.AЊ(g`__Bioczpicٜ8aryow1r`I8agoPihealthybj'''$u>L.ɴtefan10u>,.icHscuE3Kovacw4C.Ŀ`5>. CyÔeEmerHcyosphDetm^qiPyrai,%, PuХɟ8ituMacǚp spropIasiTsoariIarolav nivi1(c9PhacHDphysicȁ8CЉtechnologBucest.D.NenitɍτqOrgc׃,үNBackgnd:*nucrî(onpy (NMR)ryYid@½Jqu l0:2flutQadv@@beifa1requiXgᲓmAsamp9provid;lew"xDLnenereach1HapuilihownaXaseyf(Ynٰxopf+r0jrehnterval+QH x0ewtudhavvigȃ3ദngx z?;u0oge,ex,ie8`ac8,odasqdexims tem˸D 3qybtaX glob rofi_ǃ$p@iuЊveu֏der-re lifsXtpGGGG(?ONH-.eslish?rangeor 18etabolitessell.hecrofilwereomparedith 11A-838g`__SerumdiMt:hm`sys,ipemiaIcu`ddsourcfrroY0ar8looxbsis a8 G.pi, U.O. ismchca,zdasped ero-Un8rsPa,), 3LipaLH12Ic8uIre1tiv8GESULTS:O a0tX253?recePyWSthgh،1- study/0difip12f(5%)ivaX`degre vh313lipaꈑ344؈i.tdifc8뚑wobbetw Emergdâ-Dep t7%X4%,<0.05) (datahown+1)ONCLUSIONigncanumb8(o/ahpl`yǕНȀ@g@uTئYasЌinapptOo(e.g.Ysomell onAs@rcedu8(rapidA4fowKSI IlasmaXuiJach3ynlimit0lȖ@unΙults/p~10pta0>-84PoggAbbottRCHITECTɀ (ISE)oduE6NISTRM[SigmaeXcs u>J..ago,рi,.кone. ևp h:k"`<(EP5-A2Accuy. ‘/Rk’ qaag150 mH[okstҰzࠠzm|rculz9Westgh.c0=[TEa(%)-BiH]/CV8}1YIʋtat4 iRiliBÄKlj5:'%9''7''Ô(lȀQbA-85gb__Investigationfetabolicisordersssociatedthype 2abetesllitusyrotPmagnet0resonancepectroscopy (1H-NMR)???L..tefan1,.icolescu2S..opa3M.otׁׁ4ׁׁE.ovacs`.elean6>. Countylinicalmergencyospital,partme^Chemistryrai,omaniHȄPetruninhtuteMacromcular,roupBi,asiyDmand͝.DiseasesUnivi1edicinePharmacH򖠄arolavilaՅ_____physickCtechnologBucQ.D.Nenicu'qOrgc׃׃Ђbr)Mackg`nd:thereatumberpublish pap0nucrww(r{al8exhrse (Qp:worldct0nfield,YrЀ onlyew'Iult*d(rmdy (DM).Objs:ԃaimfirsˀstudyasoomeʈhdfileetweenalthyub DM`tiȉ؎ingobtaa(lhexpsc`qdeXxsmpsA8diEabsreȁGnex=th)evaluataccordhap0oHhhan 5h̃h겟stێareiharukHAvDRX 400Hzher,samm8؏Jmiebhquipp@gradpz-ah o 0.9,p1q tockolumMdium 3-(trihylsilyl)-[2, 3-db b>]-1-p` (TSP)WWT2WW>O@sX@adXS??hahwiesatădatcalchYCCBSt015.1.mmol/ !(n`ҁ:gnifȇdiffٰ͹;3-hydroxyiso cid (0.01<p)h2),pp1#deہi2o.05)],1Xala1,amma-obutylyc.-N-oxidit[(]tRǺfoun\`for,yruvdπacj1la؀similxbooup 5eoleH8ochighаЄoo)kbelow.׷btapOionsfaline,actatHpyruvPndrimethylam0niabeticshcreasedithhbodyasIdex.her hig`rinaryoncentratiforlan3-hydroxyisoXericcid,i;d73newlyagnotype 2M0hs,hileuehippu†1a*exx(,amma-aobuylyc񋿆-N-oxid UMethan 1ear.
:>prestudyxrovdetaboltre0 YeMRAfiXg(uHryPneHlargieЋ@lX`extensivt8oalross0KfRiffІf orpn2ies8mBest1(variouspecsuchp1,biochemistmec@ismZdissro@tarל@rke(pXinvolvem.

TpdayM,u26!PS 0:  10:00m - 12:30mha8 FAcT esultsf/ς7>A-8dg_XUttyQuX qreqAyrackdC8ic(Immunology̖u>W.te
,..ny,..ombu . Mayo,Ҕ!)N, A-87 @g`_\Pre-aytiarisffrDiaSiaisonD.owak,.tezarZMehlg,.ajechowski,.uzzPC.eldkamp. Henryordospl,e8it,I, pla.!fPze-thawy.nc:vє, 5, 10, 2 50 µPddeachfxquoPɓ!QHigloP҈ыas0Tex (05 - 600g/dL;b4 =0-2)bڳ/R,߷RaX@ytriglyckf 1,0U]a3nsLV8ȉsUixc ,e0ftifug00Aire

1,Lyers2MGantz3S..ahn4R.chönbrunn765770.hienp6DBunk7H.hristoO'%`''ʂ"Eckfeld 9;FPo߁ߒ%0CNüb(g?Sturge?p>. VirgaomwealUnisityichd,A,___A__AmernssociۡiCCx(rWashhtonCi郯SisȆcaDiagnocNewark E'''i!''Loyolaytym aywooIL777i!771ifeechnologieBeiaǂǂЂǂǁGh行lgiuׂׂמׁׂNInptuPStParda sb8p׃׃נh׃ׁwMarylhimoreXisot@ZapolMNMedogWisconsiwauke@WI777073Paul-Ehrl6ange8GermanЃRoyfiP8Edinh_ted˟dobr8)Mckground:bjectpasoeveloprocesimh har8izۄ`laboratoresultsmeasurhatoot reference4tkdpsUrom_ρρustequivalenablffLusrguidehpٍag".imitsu7sennadaXdefUȁ,Get:p9c8utabil mriallp aRcpaI.GMethods+AACCnvenin8nЄin 2010OߎߐL,,ptrrregulorgasvserpЃ@(vQ90r0ipanexamdssu9poșQagreX0ievڒjHd=:frauct (seeig`)sȏ[Jght瞸p (HOG),pelworks (SWi71hl{}HIG)illcred@yhohd`5n;coorxa) scitceinputwprᑈ;牰9-riagnocsdPQjou8ldiarGB1gYnҖxoiSdheck8( bpriorzlsecfIba"xyxWGmaddPf`. AIGillanageh echnicalmplementationfarmonizprocessorspecificeasurand.Ԃvbduresbeevelopedatnclude@dividuclisaianels,ommutabreference(terialsndufactrs’nalibrcontrolsPshouldinccordawithJCTLMityystem:leao listingqu8' DŽ„ PregulatoryXquirs.
N/p>A-89hgc__Acccy9dataenYroughPx$QTAssxgramme{0ytaețHrohemPxwwwsS.oty,.Úbell, P.rmong,.itzghlRoxabooriLtd.,rumx,niKXdom, πNBackgnd:ɜm(uspXely݋Hip9!ϔ`5yb@ltwos;i (apxiargetalues)whic3lss irwPҤ(g!hessayڑكoqlrpyf@d)jЀu`:workloÅc@o8eiaɭc:aȔcIbyʍ8,5RQfi!Honachi d󅷇 ҋЉŸxOelevi:װʂ; /(,Me,q eeU8es xop)MaHcipeZwr8`y*R`oɹ8hotZO?pidtBxq//yFYcloy.uߋߠcṈit>͇ology:éς(HN1530:HEX2),8vaفc(D,2hрviousװDZT̤
-91PpoggMonitorbsoluteiharmzaPT-Q-iveearxp:fromhe΋erls???C.obbaert/b/u>,.ranck2A.uy@s3H.tstra4R.eonge5Jleinunnewie/-6//(D.noon7Weykamp8>. LeidUnXrsiHospital,̀,OdgggggHagaăHaagMaaszenhuP,oxmee77770 77SKMLXijmegς؂ERMCot(dam`ZoGeldeրei,d7777077XntuNieuw(!WWWWPWWBeatrixײ:swijk'#)>Mackground:8iresultXgaborapajmi (1medic(geHwЯѰst0ard artProficyeнsDutchŲOrga@erӕ@.n Per@chetry/-slQmutablfhqzXhumsH (CLSI37-A2Jlipids)(argetEdefi@/fermHods9JCTLMndod'Adesignagutha $c(be@trussfip,llowtovalua`annuycle}724 ,ahcl lylpxgqassayp`q220ꏈpȔ?;8biweekpڅs.M:oBt؅+yVsstudpXer.diρψ0 20052010de迉ev 1K-)addleaanalytَoasHalculPromjdeviindividْoʖۀp K碈pJ,oAtoI ckgaiЕ3criHercentag2`pђ\ed_ҩk:W*oxlectrosa+>,ˁl->t@n 0.9-1.4%Jdidotmv/excep LiGGhONwhiZ745l13.5%u'' CG2irph0hurea0inlucosropp-6%3%,Dm8sWWse77)Mg/////Y\ 4.0 y5qFnzyq(ASAT,L1γ-GjP8K,D-amyl)deia42gH28V8h `1lXIFCC-standardizednzymeethodroupspdiannterlabVsarrowto 4.3-8.2% 2010.nhefipidsndpopoproteinserealvsompar2005,ingowo <3%orholesolTG,B473HDLc,̀21%†2a0Oanalytes -enzss osmolality,actate,XtalKlbup,ilirubin-constant2dnetweeq05butcreasȂqD^platHueAHaratioa#
A-920Pg`__ڜntignosticitfcapillaryphois:linicstudythviewIareu>S..ho1,Kim,..arkׁ..eeSuhρρρρ. DetHLabo(o(McinxGraduqSxoKyuHeenrs)Seou@a,epuc ,مYCahI<7Cזז (CE)IDXly֟piгitsghput,uicknestechxvenie.Ȫ,9m(CEbalsoxporة9wees03nusu8sRwhic:zM*p (Se,yssFHce)donourgyno.1;PuguQ 56-yr-oldn 0nsferiɮ() suddlef da.rapCT x(Iopamidol)pc#peacbinfar҂pRIffinj,J-xrnaly.ePunremHbqua`ssa inoglobufr0lch(LC)rshpcioppbp*urQoApha2Hg,$noxcPYtyp.6ayplexdisapqonfirkinXspeci0ConcludO9Pكpisrgy 10J@efop 20-yp¤ЃPadmitті0alxxaximcuh''bh 1ek,䏀p0hrthaqGGESix4h蔘fiюǎǎhZJU,ilikX 3 61Wfnephritsyndrom_Zסӗ@3(ptemb`becaaggravdackPinrĊ f,lambdaLCBed ka/RioٯɁr.͈o د!Zqa''$FrradiologdX~mi`unched-)bAl ȃBM@pi򀘘t20.2%lallnucle*ʸ gelgdrevealedlearandfestrictionnheammagbothindsspecimens,immunofixia"electrophoisdentifiitsambdaC.inally,pX diagnoswiplascelleoz.
>ImidolvolvQn 3,!(ɂXs@eak0Xalpha-2et.mIapoof tperompalonoclox*falgt`inoMЅsubc.owever,Xuldfဈmbltudy x.3.lthoughsAscuzn8mitˊ Vt meHzCEXcogniz)necauecs8itivity.͗ozJingubscpsrkchhengkye@hrBdyp0ormelGDw@`quЈ(samplglnȎn`uY(iniciancoctloI@stafinj.׃ug(multi`ologicdaiɉaomb8Q ito"relZdisor /p>A-93gb__Mtre(U0HՅCtekӕ0Dipck`yzerǃǃǃu>Koch
,.urqAhockenfupJ.chilgrLkKarMayoc,҂@MN,i0,wBackghnd:Юsng0gÈ apy`quiHfI1 um)(cryHz߂؀haboPkidneyHhichXҌxfailq(at𪠱0o婌Yaryima 8ween 7.08.0RcalishXvadmbicarbtH@valbu(SieIȰtheB Inc.,eieldL)oxn$!c(a8'"`H (Accu`R15rXL15,ƈrȑifPittsburgh`A)1pi؎hm8;Hhh0ppxy;޳Vpds6@}^1-makticjvbBiss)ap`pG9 Ja>alk./ds:oiip@HO(?,d , 116 6f i@{w`Y Xׄ''"aԌhǓ0(P؇fs"Hni(b҆sd!''!?r50nǔ6 9cx^yInoykpu(Xdefzhep0biaXs ≤0."t`wP.sʑчhuts 11-arg؃rangSi)g-m9dlopǕŒ re˛7҇:ƆHWYt3ȊQ(SD)*-0.71 ± 0.37򋰁non-??ÂXVOӝ9sph, 27 (23.3% e0σP31@6.7E8ʍfgz33 (66.0d 25 (50GWÁl`oncdem1ymctiX"G⩟0isxagge8rן_ethotrexate,ostikelyueoherightellowolorfsampleausedyethiabolitespatuldnterfereithBdipstickeading.espȀispparentias,liniciansaytillres႗(moniturinaryH atisceivyPc a)otosdevelop؃.̇rai 8Pconfirm"hX*5shb8w-tweenandgresultwhichD"onvidersx bo(.O.

A-94gb__EffectIrStatuAgGennPTr /TIBConvaFac؃u>J..cDonald,..uon,..aumann. MayollegZMednHRoches,N, @b>?w{׍1. F ^sh9gn@canyaff@WT (p=0.005(:ޕ(1.04ɤ?(,ʀ݉s2ǝ;1.20 .hioiy)հR;t2)Y9BlrangA"7GѦP؇x13<0.9 16.̙GG瓂Qreasonab0(slope36H2A-95gb__Effectsfempe(uand쁱niIbilityQQrubin@erumwwwtu>A..ofescu,Ԋoebs,.hu. MedicalniversSoutharolina,harlon,C, 8hW9.6 ± 8.1g/dL ((nSD)΂ڂց9.0a7.Hf58.89.ς*+F0/ jpan錯anқ[pӔg8(q>a, =).ɝdeeWWJ10.21.75s1.9,WRA_ZO_DŽ1lZՃ9.32׃4Uf9a4 6.ΐ___^ 20A8tЋ׋ҫyȐdecr8.43̈́=i1*31?=co@wÄHl:…HrelvsprefrigP;to@tempQlсaarknvironAP׊h use aduabЊ>but0ne@ nc_\.

A-96Ɂgb__Eccoll)xtubJ..l-Khoury,..uncpS.ang.ClehC,@,H,i,wBackSGGC(SDMA)bѾnYPaXompP Pinsufqxy,hio/.A.@rgpromising?piysfbaardiovascuPsQ.DTA plasmaaseenhereferredpecimypehileerum0paratorubesrerequentlysinlinicalabs.bjectiveoom (SST)ndDTACf1Hmeasuretf-argne,DMAAH,Rtoetermstability逈se@alyttif8tempe`(MethodsƄ4- ison,eft-overSTGamxati1(n=20)xtract(чDding؆H`Xdevelop\validaliquidhromgraphy(emasstetry (LC-MS/MS).Gstudyr5n=1obtaPquoJeachRfroz-80°C.hf9{sqt 2-88, `ၷroomW(R 0pH ̂f 2h, 6 96h.lll,thawza`batPAssay.esulCˁ0withWs,@ mZhaQsignif}cHȘbut`.xhigh@uLJ.Ɇ0dditial poor(r=0.2180) ao`s9816)twБz1 ٔт1 Rconߎ boБ!_Q֔.Xncl`ϟ΋((changeyڟSInG2p>aivuh esconǎׇcZ:qNjUyly.

-97PoggEcक़v1hglob0inGnkHbA8LinP>1߃ށ`/u>,.mery2Rttle3S.anÃ؄ohlfׂ berts. iiׁi>Det PaplogXUnrsUtahealScii聰erakeÁx؝@ARUPabo`oriIc@x3nmxl?;Misso8olumbiMOxNMackgroh:'chϜ(߁)mostmportimarklong-8mess偱glycetejwiPdia`PmellituӃdi辩toriskcompl.PHext9meeIfici0yndor+____gno0.ԅeXautҁtxgoals„Xrapsetai߄߄߄߄۹pHvaluIXsxnt88t rovidЋ@ar¹ultaccuracUcan₈dyX"pȚYo )-HewavestigWWWWWWWosaHbC,(D)EHbSl.Mb>:עeloodaxw1collhEDTAub!ay8bk(hfiinRchromgrambtaHdaio-Radւ+zer*777777`mxus 3ifferenton-exchangePLCasedethods (Bio-RadariaIIurbo 2.0,osoh7Modend8׀).herimusoronatffinity (4ultra2teco0idm2east-squa inearegpspsǂǂÇperformxu gASoftw (qInstitute)determherraitsatati8c0yׂׂsignif0di@r(P < 0.01)nPss@lve,Ǐ.ehgnalysisnese73producBc+gen Ab1cb>Lhf0rrx(librbiLʊ#fromzhomozygiroup,=attributabl/G"evaludithzQ± 7% 6%9%z+m1(ie,420.63gggggc4ay҆HconteCAPi0agradAjSi2011.:>ׄbservxwIAǓǛ'Eo@`ȱlarneges)utoۂɲ.amplXtaXHbS)߂ڄ8>ɶ.φɏ2w)noDxy reeѣYh׃߃ߩ|׃׃׃׌AlHuga@~ȖHbCӛG8,B߂ onorder(p=`540)obdulowumbps섗oncl(on:ompu@8  in҅='ҋɗf.aatoriXulнD2rirbp.ngo orOdifurimvac a777771asurem@(x.A-98gb__Qu4)Cre`a2APeritonealialyshlu___\u>N.regch,.cG8h,kYoung,ʁasHBaxH(thc9Corp) ,ҁdk(IL,<ʼnkiʊpatpnɀxing+0.20 - 2505LLOQ)njLOD1ԄDŽspxfqcGĊlys凩.
>9R8oxWWeAmethodchoicezquantitZito҅WWwithigh˂HdextroHicozia>0A-99Igb__THEIFFERENCENԀINTEROFETALEMOGLOB(BETWEENATION-EXCHANGEPLCNDURBIDIMETRICHIBIYMMUNOASSAYORbA1cESTINGu>Y.hu,̤pilliams,ĨdrewxMcUni8s`SouCaroa,harlon,C,iДOBackground:lXethemoglob(HbF)anXXpr(variousdisu0hertarysisteWS, β-thalemi@δβYmanrHse8Studhavt`lns8p`f4certa1c,`14.8]5^5.3)/onclxJť't'ݶ????/small>
ssaysnatientsithlevatedbF.heiasorrelȁ1cA-1001p>, S..azer 20u(M@.orG????BR.Ƃ.ouz,DŽ Salvagno 3+ManScarteziniW Pichethippǁ߁4߁߁ۏGuid. Federalnrs\Paa,uritiba -R,razil胇Disticosameric@RioeanoOOOOxOOVeronay,ր,talxׂׂ׍8ׁׂmςɀǁbrp)Mackground:iciconsiimposerogsolidclcȥ_aciies;anygreetingirerXdeedyXtworkKcollHponhtoZmHsghp@t/,system.oHpoorfsageq/ǭxknownaus@ prely0vaЁa,rularlyxade(aemptuh(T!ndiaim8o巑8infnceTnnHyroidfe hormon0txMhods:z?߶#f(17al`dpfarfow9stardyced08Xwi`)aaissuillum(pvior1avvenoussiBن܅ؑwodense5LSTIdv@e®cuumub9!clotHvracryl0geyȀ(BDցiner®).llde`eot`fhcoaP at(om,Tcrifugȁ02000gPr 10inye(IKlaȎTtrdefrig+5°C)9hroduƚox (ColehهтH dfour-coP0reusable䓀pxUarbopoli(@(2Q`q5q၈lib0Tc(Trix-8ԝҀ®,ogTags,arvu"sx֮`ifyBur(jϜgi ydeyق8`X;a3Xrjbop߀g؋ X+JHe Htac"zʉA®teP, (Otime),GGGוl"xtrum oche/Hitachi͕H sŧ0h(JĵƏ`,YBnur’pecif!uspPtahgQhnBcludehfree4 (FT4-m⯵(TSH1icle''8 RlHzLHignڴDdifѾ(e(țٔX0[ҶḰэ"?oraspspaiSt0ntrt-q᪊ckaQn.ot-{daibHdSHLHsjilcoxxked-)#.PHqib er8t < 0.05.`:ӁtbHvpx,H!s̫oxnteriorhowedax. 10.8°C / 51.4°Fndin. 6.343QF.hexternalrangeuringpsportationas: 23.574o 3100faboratoryefriger+drom 5.01Qz5428ours.onclus: differencesbservamoresultsreikelype1influYondisGGo0Mohatten‹uldeiventhisre-ayticaspect,ymprovߋmexz7,Prderсdeliniciywith@liabl(data.

A-101ojggInvestighemolysactnlasma iasurem7774u>J0.l-Ky
,..unch,.ג@. ClevelC,@,H, qpEDTAhok(5mL):nypot0cr:wHr ov!peeze (-2q).fAi(dilusae,b߅Bso{8ꅈ%liquoif index (HI)#;WolBYincrcycـcrifusupt؀hzHIoe@8.agicRpduXonrsplitӚ9mbeeЗ끻RPe 'm„,i8e)szhǁtha(!3:Սˆ_ZΊ!t 29icol/LJ53L>10%8Ꭸ27.6116.5,ѹ٢l34hawwv19.7814.2{Fur?QdnA(ungsimilar\GFŴwag`ˏFig 1C:Ьw|not~da820elowXsh\Z+due4SPPm؂x

A-102aoggIscip@CalcU8eeceHryЭH!tplpo@?ooolu>S.̀im,aOng,.awCi. SapNʃUnrsityoXtalE_e,NBackgndp鐒vsDsucm1ciIrQalt, J?jsoonfehissualwaySrnX0 1ouraboo0staf褰p.ɰa8study8eke(ct׉9n.MMsҀspXE)i@m 47Vtollpbottouhes18liquot`156|ydPhloric(10-15 µls)pH <2requilib[roptempefP1.o@ sie.feep924,heon acidifiedampleasplitntowoliquots,ithne.ouris (non'n u)sellAbaselځowernalysforalcium.
esults:1te8ojrang0.31mmol/L-9.5Smedianf 2.3Ӄourtud@howshat(noatPiiffnce(gdcontrbetweentroh'heycdt0oxHaft24pp = 1.0)Ռʁ;J3imprecisI< 5%, 70.7% ad5%򇷇Wwts.,biologڍin-subjectariÍ7.(ȁ8byricos*colleagu9b__iSYsignhwߏ߈/i񏴍iL8storagO>ÂlonW{xW͡masurpYteceHOOIYdom~spY.

-103XwooASSESMENTNDOMPARISONFEPATITISIRUS (HCV)aALOADSSSAYSNЁ`@SITHENOTYPES 2, 3, &; 4IATISKOPULON{K.atlo z1A.ox߁. Coop0Un0,YC)NYU777777Mefio er,ronxׂׂׂӉ`ׂׂׂMׂׂЁٞ6Background:epxiru؛infxs 170illpeohorld8Xа@dcausecirrhos1livЯc8h@StateS(iveem8efcy"virlo8toogu curtarda(PEGɉYRibain)rapy.ltxghrRoc0iuprov8onlPFDAp@;QquCRNA,b>iiermsgeyp24.claimskHOWueYi؂ehdimmigxopul ,hichndXo肨csغPva؃PH%(2%0.3%)NY[)ds:Ԃssxcomp1twologCesthdžwnervicbyϛaÛ:л(trot(alyy’satas(conducouCP. 143CVs0-s`leHcoll(625Q294)IsimuleousHho(bA9merpHl (Acrorix)w1,ʈB@firmnresȃLas@,2lo2.5`gU/mljbtaboory)e~cisfEreHibilitthreeunQoneekHaX"G:ϓxT扨Q;Py8biHbet薻Taqm(aӎ€ȉRealTime0.2fL (p<.001)Ae(fin!keeppublishx(ture.ɥȆi0obȂB3atientamples (0.34ogU/mLnd 0.12espectively)ifferedromheiasbservwithenotype 4atient03).his+w confirmPincommercial`nel53,831159,.69lor>s H2, 3B4 aighrrelon3?;betweetwoystems,fewutliersEBlAltmanlothR2A-104(ohggMusc(damaginflammbiomarkYred@physȝ/n7774u>L...unes,.̀azarimzPapaléo,.ohlJBziko,..Hao. SੂCinUn0rs`,,HaziPx1se(8ot-m@rWcup"Phareryeead9,levfytokiP:tepi m(RI)774Caif8studPТ`ePIˆɔ o??oMe ds:jǁg0deolu9(n=146)t8a 18 ± 1rariHصh"a g (ictxtrollgramichsdomPnф@aerobic;i+thXdai`(f9dpeek췱‚xt).ŝ)LblooYc1Hubise؍Qlobtaumanal Vaccuete®rPP-One Sl}כЁ8ndardd؉(,f 12fastp,mornhcrifug1.80015in8s`rig9)(4ºCcre@0(CK(CK-MB%xmyoglhXH- (h-CRP@co3ڼa ɇkR(oxP"alibKnXana<>TMa>A-105okggEosinophiluriasommon(gatientsfterlealnduiturgeryWWWSJ.heXg,.onebrake,ǀpella, . MayoÈic,oc@`,N/i0Mackground:cutenstitinephrXs (AIN),ostssociatedthriorxpoxeop(ficrugs,important ognizeinche3resolves#hhoffe(ag Kfrequaboratoryscre(fȇ auitv8earXnaeNs.ӅechianurbservQhaPamplxobtad om2Utract2nstruccppearKhaannusuallyumbp(hichPuldf(!,kurr studyaserxmymcexam)у3ȃ8uethods:agbweidpthepaȑhȊfo(n=20ach):sewrMs@lidx8omГ`creviou (S);c"submit7Ěx(Non-a@r(omIelecA_a탈mum1-3)-poфHieP(Contro9z.՘gbuYzHel(q9:xdardprotocol,l0bded, prea)sy 4Ϝolog8xȟ튌@pc0w#/Result(g [si۔y,1Jverq19% (X0.25 - 63%)]@py a anyN c4arisonXƕ?rdW:ц j3.537˅:o0aQ opy4.6oh24//Il18/Ԛۃ^had >0meec8a BonclP:ІGonmarkedQlevڀ@eЕir faceed1jp8oo1ڰ(Iggysot؞fuᕇϊ.

A-107PpoggInflamor9bilityLi-H XplasH(vꅑ@ph߃߃߃u>D.q8,L.ylebWoodwh. VertnrȘ`NashvilTN, Cytokskumnecrhaclpha (TNFα)mleus (IL)-6‹ȁx@sucs-@hae(CRPlipopolysacch`de-bbtLBqzwꩵ!diagno ct!֥IeЙ`disea.Ⱥ8,퐴@analyPhrlaXunknownbj:o0x8COH,L-6210,RP#!hum0i/(rethods:me t!follMQyP3our"8tiRГ,H(ft-ohυڱpr 14`aliz3z-80o

o>Nǁ1σb>A8po/gcizѓytCi-enc9urbidtric@say (PETIA)comsh8nephXwpru>N.oskoboev8h.ar ,..uqJ.ÀieskMayoË`ic,oc,N, OOLBackground:Èinnvlood-bor8biopk(uso ess爑rXril (GFR).oti`advantag8ovXci٢Ȟ!peh aHmus0ckQMs谀b%riPm@espdA.ɭшsw1ne)vaО"GnSkpxNZsRY,aNAI뎠ceBԇERM-DA471/IFCnᘰfm@rح7ethoddifjttiAcohor)Sc`ied. (1)̃ven(n=100)Ŏ perHma 501 z蔩okBNIIP2)ӄ105sQgoingola arylearBPg (dit775measurtWRv dexi{equt倰 H`3)ankpstt -70ºC200n=67$re-;/!uybta8dY2c J00ҁ5,w00.33b5.97g/Lxth@8l`ta(hfE5rpondCVs < 2 %h{(sXX25-28%8)croall velIos0텊@b.urǂ-:19whЩe>H"񝈰q-b 5hiPДepPop(o:-dmʅבd򄃦0yHCwws71I_lpoorl@unBQcuhGwAcKpxSdriftYs`cbeisaċڿRAaouPhemauto.Uʓ8vious@n>ac H`FR.App0ovsignX 1y ly-⊛ovpashecadproducXbip2Y8瓞0$,f@`@8izՎ !mphiѴzЂh܊8.

EffectfemolysisnheardiacroponinndreatiessaySiemensi9iVistaL.oquero,..eldkamp,.ajechowskiDollH,IAlA.asudev,ȁV..uzzi. Henryordospital,etroit,I, pb>plaކڄPfreeze-`wyclvolumi (1, 50, 2 50L){adq eachfqaliquoʌfiHb҇ɪmzbaQD/index (ran5 - 600;4 =p0-2).?rmxur ripl(tPaomoeousu1s!xyhanneimmunoڈõ4ablZ(AMR) 15-4U??G=zmodif!JHX4Ymophot 510-5)mآ_____XD1-2ͽؗh9lmߏ':rsubfHB(xRecq[culert~x?A±5%b10%iccept®疯_ sults:MoHproducaeg8rfpRMoל߆-depehЎxner.Ɛ, %|ů(9itONO81( ?Ww*7!< GG.× 7ǒs'("dp0uoGHb.Ä`lus:׏hm hGmcomxmiT@gno邨acuЗfL.͓mɡ钿ϊGA8%XbiaXshoul au/t[߃߃߃ڽy A-110AojggEcBHBilirubM+qsվ*sdvia 240r'$u>M..ڵer1,ւ0umarfont>,.uerbach<1Hb>100- 0g/dL(toЈw (Ta)nd y75wreh(Dz.M{:ՙgHockхy19,3^SysmexE3),work!soluQadea1:2eridiwalڇpik(1:4v8me)9o堠1eighnoo(finH+: 15-3,9)WBp7naddesignblankntrȌ, <0.1-25.3#;Ā߀16.4E!bdividˆpthreeliquotduplB@ultsveraged.蓧†sșif(ifw(luchan(>+I10%ў)߆ ҄:Z:"Z:xnegviasb8v atJlow؋only`4-97%y#0.5ʑ122_92 1.7,950i 4.9gi:simoס(17-2333_ׄ0-68i 2.52444i 0-7.6488`12.5-19.8 97:ΐGGGt"rOJ68ώOOЇ;74.6׎|;xg''襸/u0-2'8Lj׈׊3-18 18wu>2Xall,begintًpG25-550.2?:X61?8끭WVo`݈O`MTXhuppsi8rJAtisO9W#ߗ 0Ȣ,6NYV1ă 36g89.2-筟ǗCxluɼaBhutaniomogramgorizXkernicusiskdnour-of-lifeW1a,creas1GhadinimclHc@y@0mpactQ.Ղ H, 8uldalse8plapnewborns!o:zone0especiʪGgeхjE,c Ѐmedi؃I_ey3inaopr"/.Ϛtform/3orrexassumptgardt’1tyoXnju鞌.

(A-111IojggCo`iBDacinRapidӗ(mub4 H@!losuʂ SSTˊoutÊ0istrynalytPiwonutЋ_eight="0pt"idth="0`>D.zamosi1,͂cott2K.ockׁׁׁׁ.pple߁߁3߁߅Murakam,ptankovic.inocchio.erubǁ. BDiagnosticsrlinakeNJ,AWashingtonniversityhoolfedicine,.ouiMOi7innesotaapolNbrX)Mbject:>heicalerformancetVacuta@r®apidӎmloodollTthHemogard™losure (RST)asvaluatednomparis0 SSTiہ )nwost@eplats.eng8 19ou舘hemiynalytesRoodularoxstudYD6GGGBSies98xLaecoh.Backgnd:ʊssnewctthatnAQthrombin-basclotᐱat)aelarrierX@oArRz,llowcrifugafinuafterȃvidو99spec)Lan⋐amdirlyprimareducUtXdecrē9cessAenhlaboriyffenc?>thods&Freshmse au:QaPngdلxdist(syphlebotomؕ!-venousx/erawtou(Č)B (rol)ҚHA ,چ܏ՆÅpe@wwtyhour@;daځzdYeisjfxzimitsfPsso򂋀\1eacPsmaximxRabdiff(9)aQ8Dregalsug҂:llGGariia؃Ȅ`level`exceplci(Cagamma-glmyltsq(GG//ʫ carbxdiox(CO2tsymc=Ca,GT0;PwrWSlapp.a9posiy}extend 0.3g/dh2j12.84+; ne -10%uUGXdemoY҃__1mol/LreviɍbOdP3PacGonclu`OX,Pqulς *ϩowhƉ2iiɟW`i utosTPyelpio`eoday’*ؚcmorapid@porɂ7imghput.

A-112ojggBiologT(c P81obe pxasafetyG.iOlira1
,.ontagnana<< fize="2">3C.uid
. Federalniversityfar`,uritiba -R,razil2Postraduaterogramromianoc1forlcChemistryHCPG/SBAC,ioeaneiroRJ''''p''Veronay,ր,talxׂׂ4ׇׂarmςɀǁbrp)Mackground:iabetesareequirqhinuousedportndatie8collaborxonnrorev/reducehiskYlong-termmpls.φ8Rpa13earsdih`icpproach1hasngoneanyhanges,sڂ9ceriaasednloodlucoseXsaydatausuybyorinum؉P@exssingފc[.sellnownaisultPspoiasetithІonfideH`Hva re`cc˒HЏpourcȁvaTimpactbiolog"bx@lmoni``SsseldPsXaa䁱errЊIphysicpAim@ork膰e0mq)RefCzalue (RCV)0ck鄁ąrapeuyXagemqype 2onfHowPubealthÒΆpAdȂxxp/-PjeExpTÉoli@Fami(PSF)Natéruipa"einGxqt-w8e 100%ypopulD`{Ha ods:CV;q DifU(CDڂЊSFP`Hc)Id*df 8 8#5gy1dɌAe χD(quarȴȀy 2009Aprilp10)sub(cʇ Ply#N (%.ן iύlplpbtain誛h(firdrm)jlsfare`IFRASE/F)Dgnif,Ts > 38.4% (p <0.05X6.:> 59shƒ( sX6† c41y, 1 a8Asp-lifylAd 23bo ߁߁ݔlypoglycemAg񅐌X b̛IԛcouldArir0t`1tro0(Ai ߬܀g@`ҴRq+xocieclaimц@pooLlh0 @89.6%S18sh73.2 2. clu:WWWR$l׊`noЁggfsugghcliPxɤbtXeXoolikǍJ0ro@@)bcin8@icor.

`A-115ojggPer:hle omX+ v^iKeu,u>Fotchway1,..ek2R''3G Add4>. C@LServices,VԳYHospital,ccra8Pathologye8t,niversityfhanaedicalchool,ccra,, 3 15(75%)tWhadTighHwhi18(90wwwσ''$h (3ggGith(ep{lis8 (4׃8ǃǃLJpsksdž20(10'''////14 (7ٝadOn y__Widusx)ϡϡϡʙFDz߇gahospll󦗦} f4????rsgnclusm@a#rrT?\4ξCreljefficrgЗPa?wasnssoryPe;fS.)sidPd;impleCPanallgbW@b`i0mmiznalytlman 9rovJfyces/p>A-1168XohggInflf`ffؑXk:K2 (xK3 )-EDTAĉEryth@y(SedR(ESR)G.ima-Olira1. PradНSiPhaceuS@,epP9MpPathologyeUn rsityzar,è tibPEBrazilxoon8ooSon1hcalxcDipartimentoicienzeellaitalRiproduzione,niversitàgltuVerona,Etaly, 3

(n=31amples)AςGGGG>>AGт 100%ׁׁׁׁׁ7φWWW>!W 86ρρρψWWU(ON5ρρρφOOOMOׁׁׁׁ33φK/҄a)onc:JdisconuפmanufactuФahmP of70lepsoXnoXelHe(egArGG.owr˼ϼccepyywucrriaء,Ӛ,,ιLjgكdeminofosve/neg;sx O1WA-119&oggSTUDYNHEOSSIBLENTERFERENCEFIVOARBAMYLATEDAEMOGLOB DEMINATIHBA1CHEALTHYXDIVIDUALS,IABETIChD/ORRxPENTS'''$u>A.nguix,.astro,.ernandez,ǀoboЀGarcia. Hosp lnrario.icto,álagHSpain,A-120PpohggElroductivitybaciadqll`wafful@nalualYlclinaemPrOOOKW.hen,.u, JHu*. Dept.LaboorpZhongnospital,uhUni(,8,+ *spxAuHrA-121(HohggE9fnewՐcidpplwithnh1bustness m؀\rKAbbottRCHITECTinChemryӍsu>J.otzH,.ick2R.chwertLackner. InxtupALaboratoryedicine,ainz,ermany, 2esultCVB1.2 % (n256 µmol/L)0.89X550.cordCLSIuidelx(@totp8beealculJwith`0 %{limiڙztPle 2-eqsregresswy =979x+0.33 (r=x9)ꕏ910rnetfrom 1071113ևˈo؉betw95103spias[hado)aupR0g!notffpkGbriglycd0qϋ129V5spqyoxamp2s0b䃨am,husdurbaBЂ=//1,3莻qGinvhigKɎ7 2range: 6-171Hƍ[d*5`lug YalightcrPnlwyher 95%9clonϸ rȇˊ07,]H 'un^pgٚ,WlipidB5ɴ(mЁ9daily׽Έ sui!e2s٩ ڃo쉏aowwȒC.

A-123ohggE7-DxSPPSelcgApBDacutar®ST™߀PTubesu>J.9,.rew.humush. PDiagnocPF`kakeNJ, otigh g-forceoleanpheample.hesuserXhenransferrednewecondarylasticontainers,nd alytengasepeat0ooesuȅachubject,woatnitialimefournEfter 7aystoragQ0bothpoints@mprisou8ehemistqanelclud immunoglobulins (28s)>TuesM,u260Q8Ȃb>PS  10:00m - 12:30mha8 Mg9tƁ/>A-124ogfDobox[rrylabhy7(atemptu䏢? u>G.ima-Olira1&/b/u>,..azer2M(.xr/R.ouz,DŽ Salvo 3+Mhtez? Pethippǁ߁ݖp߁߁ُGuid. FednryAPaa,urbPBraziȃ_____Disti`merioeanoOOOOPOOVeronay,ր,ɶxׂׂ׍ׁׂh,9mǁʮBackground:Amo9pre-#caumakGesultsnreliableYqua᪰/sportatxci.nadeoe (T) nd8onsspechdmenȄssfactAimathinv igovaljTԭi󗀊MPods:oiЁcorrect(from 2°C8A/ 35.6°F46.4X)urce`usgelHithbopolinsi(2 200mLi q5q)e9`placʁiColeman®_YcnoiologRCo`ᄀlibe`(Trix-8ԏҀ®,ogTags,darve;xPebӉifyx~.gis(^donehe 58H0TjbyY捙a`ivQ(B)?gHȉoZK񐩃Tta"zʈAnalyser®.
w0 - 30in:hinpenoxeforec ntroduction;he isuitedoeivesamplesfterbout ½our.(ma tablenlyor 9J (from120).̈́hovduringpproximate64%ftransportayime12545:)X ilityasnssfactory.t!notewxhyat 2+rrivaldestinandg(Ycondis!ppllroT,Tapbackth8hg2°CQ8@)onclus htudyhow酩usu0 Qgdoq`rthbhyo8icstruwhicheasiinfluenchbyxnpT.uiЅulderifqmppIde-Qtemperavarinyealytes,.e.rmones.

A-8ohggImvEmergyepartmePȀACaHDecrdiacropo(urn-Around-T؄WWWTu>J.ajecski,.uzzi,.erberholz,.enЀ`Ȅy,.ӌeldk. Henryordospital,0it,I, xoBg*ZAim:ean8incihaxbepXliuricpo8or+betw`tquAyl (TAT)liȌ(non-ue-addPivHɂ)ndIzqXcess8υ0Hup! 9bXh|BPcyBa@i-c@xhealthys .Ցbω,imteeRa(cI (cTnI)phere(D%lengȜ@ (EDyethod0TohieȆ loyPa?Plan-Do-Check-Ap(PCDA)yclT tool(swe9orklif),iRdispla1lpoadpyllf`owhiseed: (1)utoyid\(2)yeQex(r!EDi Ȗi 3Ȕaug(4)qbJncA 5)Wz6)qtxX2l)[(7)Nn(gists'@c.eas8dn0p's (<0.2ng/dL`t’,086{eX<څהҀ@ahppdefinaFˀIreiIXc%̙HgoP?<80%΃ya30.PDCA.( 7]9~with30'Óbser)rgradA(Figȟtrd 39irhiPooJco)buQd18%\sODugqiohxtihonRonUP營WV:ȊmsuidXnew﵂uimgdex="00040"lign="be"(ight="30width="4`(0p>a>A-126okggC*:CproughHoShɈH! ///(u>G.uhriman,.guye@A.dwN.off8,׌8Xdler,͛s. Unrs0WasXgtShtlWA,iM±gnAwهؒdi18((lectransٴlcljiȫza(Pdiseco`gearyrganiz%^5hHinvolaoutsppertbenchmarkRgtsurXdkTÁ:aՋ-qdndriEngeBdepartdd0on`veyAviewsq0ffHl8hHhpxlowqbYW amongothtaffndanagement.
bjective:reaxaystematicringrocessqunicitheepar’sission,chff+Rkill/(.ԃ0overalloaljdevelop>ۀhelpnsforculture̓҈y:rri0um 7tmodulesasRdsAdobeap@,talabouwpoursonЄXo؆݂c!Rfollowtopics:DX|vi^rol2!labsuciO)Stard1fmphasizb&chIlutequirЃЏbenchGуF:ruciHplay(bykopPtVd@> 4.œ/(, Patkhnci's "FIDysfunonaԁ"el 5.Kcepts/oinclud5S,alueȑ m0pp,kdiagr,`otausnalysiiA31inuousimPvw 6KbRerr쁨oPqu#re!(a "JustÙS"desigaighk? 78in uꗰSi*T73Fb;,XdoPzzagen)fromp100-ques"bankhiPYdPo+-speci0Ȏ.ؗ!l恒"bHfixamHservpmiassB eeunderHalsolearithatIцڂiZizp0opplheir?#ddseyW@hst,7 {safe wePavqh_b///+OeI%ЄNyaHt+sxe (0=”Und`15="Cssets") #ychecklist `?ZThR.љgPmXq2ocuSumTiU鉮skfi0c񞫌UҟjicipJH"xiew8gen)cesPs:Ʌ)0beencePٴbo;In8h axBtiҮIlho裐s62%T 23%{mhabhPpBma 3m@li(>Ð:ÒIHdeE ARlhІ ch@HPsp)1ransforioQchan)CAS]c`devel("<.

A-127`ohggLabo or@udfaciprologҀȱxr,Sagno@ccsOOOLu>Y.Ȧg1

,..rey,.r߁߁2߁߁Drmo߁3Ap.on-Wa(ope///.. DeIPathA`pMoleared`ne,cMa)nrsamiltON,ída,at`pǃ߃߃߃߃قmBackgro:8boptiϚsommon inlinicalractice.aboratoriesanlaymportantoltoacilitatehysicihtestrdering.urreguide`for`aciseasencludeecommendation*murenti-tissueransglutamin(tTG)qscreenahildp`ddults.׃lyomplete5yudit rovhee@og⇧Q diagnosisfonouhv
waxrablx633656)oteCded (1105763AJom,lone"x23.7%79.40%.ΈhospЦ’Auc554.022.2 qz؂QdiffP(altme7ǔysignX),TA1)oYsӡτIalp!dido)qՆ`۩ u(*hehenssteggo[8nck??

A-129PoggU Bi>Vari rstishHar`izPerQLimiHCuChemipyTcpesDŽDŽDŽu>Bslan1

,.un-Munro2SPp߁߁߁߁.Flyn. OrioAsso0Q,0tute QuanHec ,(r o,N,Á0da,爁灘ττ΄_^Program -̞Service FBackand:(iencyҖQ(PT)deHm`_oalҞ8low2lXWALP),9assess*nalytq4Yޥ@WLPa@evڄbupisvbetwe&)\gsnons0uKXkBT/mdneedIn 1999,mahout8‡StockholmكM๵GlobxuS ɲk_Calu؃ecOK?no|foPdxrXdatabW(BV)Ҋ@i8fewPport7-.ȅ,VChavaiHýW[QMP-LSZӃH1BV-witoI؛asibi=us!@mzhUthatb/77Method: ̆8@ipalbuhrbon,hldPglucosHphosp`Yothium,odBteP(tlureauȔpidixu`erumamplЁBdih H187)resulҀBItylySO 13528:2005obustg@thmalculadjmeanndtandardeviationnd-scores.hreeVasedimits,ptimum (BV-OP)*,sirableDES)†jminfMINerestishforachalytescribbyrr1.LPsromMP-LS,rCLIA compared.*W(%)OOOONS-ESooooooIN8oooooo776Albu8 (n=1049777723.3ρρρρρ66.8ׁׁׁׁׁ5ρρρρ86.6ׁׁׁׁׁ.0ρρρρρ97.4׍Dicarbon؍896ǂOOOOJ4ρρρύ1.9ׁׁׁׁׁ7ρρρρϋ9.7ׁׁׁׁׁ11?ׁׁׁ׍8.ύρChlor{97????ρρρύ2ׁׁׁׁׁ2ρρρύ7ׁׁׁׁעρρρρύ5Glucos107777ρρρρφ{6.5ׁׁׁׁׁ҈Gρρρρ9ׁׁׁה4ׁׁׁׁ׃Phosph960????ρρρϯׁׁׁׁ׊%ׁׁׁׁ00߁߁߁ߟ 1.2ׁׁׁׁ׃׍ׂotassium15߂GGGGρρρϔ]ׁׁׁבtρρρρϊ/߁߁߁߁߁2ׁׁׁ׃ׂ׀SodO///,0wρρρϫ6>1.2

*V-OP =0.125(CVip>+/g////)1/p>] +z (0.25?†DES250ςρρ//ρρ0.50?ϊMIN37ρρ//ρρϊ7?ϊȁ>:ntra-individual؂Betweenz2.58 (99%I/table>קקonclusion:basedLPsanuccessfullyormarmonX4lobhperanceoalPT.ӉXtific0onfg`8ngin,and:mayden0yalytplethodseed1improvemPassistaritsettyobjective,lity,9torG/(to`et(d℉s.G1OLA-130(og`Datainferi`PTSHesul(Dveiologicap ooolu>G.embrowski0u>,.ran,.eeρϢ_ρ. UnrsAlberHospital,d`toHAB,Ðpda,9ealthvi??:Aackground:oxestimates!bv (sbW>)reioRacquidLspeciH8romefereYx0followbynalysisithininglenalyticun.eemonstrateorSH,nlyreviousXobtainedair:tientesultsdummaryCataeHtoetsalhzprovideHliabe8m`sfb):0> =(_`up2p> +/7///.)1/p>Dgggωdeّatypf㘈ecut tsiZ2velbBio-R8xltrolpecx5728aiII12Xnthswҥ:Rv 0.10ɯ}$kLyieldP' 0.5Sub`tφφφφφ>濃_((xK-9a1op=11}Whexs񿰉error,ۅǃ_ǃOǔ(30%,ighc19% mЈRicosmpiًbiologw9RI`}chinclueɂinon-thyroidllnhospitٺ`ЈcؐC@ydis@eAhypo(lamic-uryxi>oi:oul8xe(ind:BeckmCxIextremesQbleitorinmsetqxW e asu)Pqout}(rerlaboray)nvironqRLJ Xpxxoc0ЅIdmmunoassaystem/xpet="10pt"dth="a>A-131 @ohggDopaь(OnloyEx)!HgISrosu>E.֌.r0u>,.dward ,ƃȬ(thn.guye,.offЁ..xׁp>. UnrsّHWashton,eattle,A,,hildp's0˃5Background:랚 s`hiot etcaiaJ,0@obustquiuHʟYIAckh.8gwo (SP)0qrgHcadeedicalenter,evaluatedheurrAaper-bassystemnevelopannlineoolpecificpabeeds.ԂgoalsprY: 1)ncreQformubmission, 2fiencyfww8d 3)hdataenerby҅l%(ualitymprovem.
ɔp, 196,482 Rx8d/g 70,227niȊsiwhi7,8181%).Po 2,46@32@s4368H.ό+191/9ka SPsAim̄ch221 (9%Only 41%eithwm(0ocio ?qusi9u(ostaffput-s 1xcep*hg mployecahrYXcribaicterrHisplayTȅ`waHoyesu0visX˃psearchable3diff򗒘;GAjobliȕilotudi!H]o#h'R3wpOK100Pgiskpart $p 0cco@nД_ChH8[0Roncl(on'ŕ'%racityspecnrong.æomeyste8Bk sÅ؇8i ѢAKQmaquayms.nmed,e,ducA$ransen7.

A-132 @ohggIdԍArou@TXZSOutԗtNeurSnoH2MeetmerhcademlogyЋearamQJPrognosPoAnoxComa___\u>Ve,.arZPortz,.otJ.oyne. MayoË(icsonvillhFL, A-133ЍohggUigma-8riceuqzX9erȃ___\u>Y.Ȣg,.m:,̥0`eir,.tHouixClearstC4Lg8Missauga,N,ÅPd`TM /tr0rၹcolspa3"owc2//Bio-TEAlbumin,ST,icarbonate,hloridPphos rus,odium,reaLRlirubinirectnotal,GTOOOOO'?}P`alcchol@eroolDLtininglucosHmagnesps[*roteinׄׄׄׄׄmyla@cဥCK,DH,ip`glyce@ur(Ǎ'Ogb>H؝WWWςςςςϝWw?WWT/)ϝu/////)ߎ׎ׂO׎׎׎׃ׄw՛'o7777777_ܨ𜟜Ǡ߅WW率/table߇W"1_A-134oggLeanniogyeliversዘedicervice;Xime(yZWWWTu>D.ohen1

,.lliso 2S.liρσׁρ. ImpCollegeealtheHSԑLondoUnitedingdo׃׃ׇH׃ׁCep0d,uckhhamshpMntroductiXCm0vement@notewurrganisБ0(theɈ///-UK).edemonsto@incorpoٳ ăȀepart upH yٖϖϖ.,Ysettoolatwivisthrouhevnb0dethod#byli8g n-ueddavitiescribesuccessfulffoirXKturnaxnd(TAT)aP-analyi馂sexis"resiadopepripւX.υgowarre 80%yw@"n 2胢oHonguishetweengae8.ȥolum8HIVՄscomeAT.MsDataap8curr$aty0pmȌ8Nb@2010Aapidiv1(RIE)b|h$oensultawhichpns@fPdaysoragow3Cpr)cXlӲWy (JanuaP81).aluetreamapping (VSM)aserformedre-nHost-Leanmplementationtheagnitudefhangeaptured.urIRIE,ommunic3plЃestablishwhich(24thA-135(HohggCbЗ) ifUHitachi:Olympuutobioc0istH@lyzHrQbloodlucoseu>Q.ڥ,؉i,.u,׀8iS. BeijIHosphl,TNrCrC08l̫,‚c,Í a, }B(g*:inP1988ColleAmpcPath@ (CAP)off(،@逫TPXiXhavhWj)Ebw@ePenc#p.yFndPLIA’88)fdkiׂPh̪apnaQXcn`uhyystemqaccuel@uthpg=Rry.Ʉ0study,1rda0fDŽǒevalu끯i̓s:AH apinxu{dataviBtwop(74Is)(733pli!eKremPsobtЋ(ɉS)is0UKEY昸xi.e.,1+.ne-kolmogoP-Smirnov[Ynꉛmodpe(@ʈ!( ig鑁elM1bxap񁷁urrJbHYAPՠloperceptςcȔІ1so9IPHiculxlOOKompؒPqowerrorI1aygn„_from 1B0ᨠtiviO limi73 1;'''''''''''''0lpercent differencesxceedheimitsfllowablerrors,evaluations,t 1;fcalibrlineasloperntercepthichststilyignifh?rom 1nd 0espectivepɁareithinerH2ateast/_______ 2.
A-136ohggS+I pemy 1:2sCjqon?gggcL.upudi, J.undt-Peco,.arvin. Bio-Rad̈Plano,X@/i0TBacknd:Obve -ŊsJforma9charac 8stegɖ(`aruXs=inxalnailsl-`˃x8side 2SDme()p`@aommpAicAYlsampHg wn Ȉy[XpoproBAbeeXqaed.ׂ=XalsPfrͤPfunyubothpP(4 simule h3oi/2/R4ȶi܂Xtwز*"firP77BsOM胈 'oD8G/+iTsЃ___?_ ڌRwinszdžOrwi[ނi({V-dy{Ͽ\{?h0atɼt,< !}O؂Z:eeНoonPwvRٌŽ_ableonclon:drawbipun[0y b> WSDUlowԩo"shvp asonQ겸ab>ilarutÆ[ÁgnifP )Ad# ˴o0gAiww(xivemps9؋mo nc19verageumbtrol-Ί׊׊Qϊ>.


C..errero1,.ota,.a8߁߁ܙ؁߁.ennartz.operĉrmbru@. SinelH.,ilan,taly,iLaboratoriesc,hicagoLnMackground:eportednagInstrucaUse (IFUs)relevaHinavapcocHpretpP)resultsXddi釈(tVy Xview8ataordeocc`t"possilong-mhiftsAethnicitylifestyhabi0h1popul:.anufactusquH0Xthqi…j*eriodicHf@׍/-byLjÇwacla؂Os./DiagnosticoH.v1vis up`se؍ aytfollowingrCLSI28-A2uid0ne.includthistudy:IBC,Фrecmyeoi񀃫n-Dibucahi@HBDHappaRLambda̭)hsK-MB0vo͒ods: 260(ruampl(130aYqfe)llfromdduKcruzasonoȈaloodankIaargeospi!NhernK.)s-wmadx񍁜pecis(nt sub؏snowx@ r"H1oALKalcTi!eddefpB2.5׫׫th>97߁߁߁߁߁؄cъieachӊǬPpa 90% nfLpnon-parametr(roggcm0m012h]obqjAssay߁߁߁LiPNumber Unit׆7773MФާςςςςςςFb߂ߌggg/?//A9gfσσσσ>tize="2">thUIBC熷ׁׁׁ4P79ׁׁׁׁׁµg/dL6ǁǁǁǁ240ρρρρρ7ǁǁǁǁǁ31ύ߂߂Cholinesterase7'''BK24ׁׁׁׁב/߁ρρρϑ38ׁׁׁׁ10928߁߁߁߁ߏ87ׁׁׁ׃26orowCystatin-C**'<=50yggWWWLP937777773mgdžWׁׁׁ0.31ׁׁׁׁׁӎׂׅ77777777779gws>>ρׁׁׁ׆???ljDibucanhibited80ρρρϤ07ׁׁׁתC8ρρρϸ$HBDH焷ׁׁ״Tׁׁׁ׍ρρρρ">5ǁǁǁǩS67ρρρύ_ǁǁǁǃ44 Allubjects@(www____ߠNumberG777ׁׁׁׁׄ.N.׆7777378.5 - 85.O7OOCK-MBctivito'''5ׁׁׁׁכω7///lt; Kappà񲨒ȅGGGGj6ׁׁׁׁׁmg/dGOG???22h437_W'W Lambd__OOOPׁׁׁ׉__<tdolspan="4"aligXtop">62 - 231

**NewtandardisnsRMA471/IFCC:xb>Itselycceptedhateferencenterseporin(e agentFUannotedo:withoutreviouserificsstudyerformpopulaf"toClinlaboratory.t’sresponsibilityfachvI"Propriatenessritsq,manufacturersldssisrovidingurzstimswUs.'1/-b>A-1409ogbEXct/PonneicehWs u>M.ot ng,.arkley,.o,ǀurkholder. XWaXnnis,i`apoliMN,`GckgroundProf`lvdir1Jsb29%U.S.ork comparAo 15%uniz(Kleiner &rueger, 2008),n9Ї(H@Hmean`oџishzma althhrHriXe8(Grnebel3).!waslargI8o 8twozix8yea@a0ءif trs.hIPfirempirZS@cechnologymftrolhuЊ`pindiHuxchah cႀdrminantC{l11(J9Puer Ricoqu'',QYmo0XIKr (6Ryse`ʠHMusettIsYssouriTex`il(McC`9).Medsn0x imo+dirch:regȐA9eV (napAogÛXvedex-adjusB1/hrI؆V\H edu#,`tia,eAuld)atab`fromÄh0 PuHcse(croSle.o (Nq=4,061)܂ull-pe///pAg25-65,SrSnsaHy $5K-$175K-2/-1,665/44sultO??a5.8%ghqp < .008i0o oQ77771Pi>R2nge ww.׌Ba5.0΋ooGwwOwpeԞY 1.􀧩fngsug aygnifhnt,utp9zmpremiumʤߞߤhPiȁsOOO0`yro؀ur0peeempir2QlePorfcalo8kehols9mx0mdswyUwageostsgainsticensingenefiincludhigherverageersonnelualityndyreasedrofessionaltature.

A-141ojggDeterminlaborequiremenfmanautomatsampl roc![sspectrometryestthroughorkflowxalysisGGGDu>D..acker/b/u>,ʂopardo 2C.ahaffey.errotta. WVUobertyrdealthcienÏ@er,organtown,V,IHospitalsbrh)MŽgnd:`lancffiGFimport`henptimiz9Phodkatory-developh)sh9shxengȁithatloYxsuchs(MS) axmiqnum full-eva@(FTE).nd z皷resourLdbMSehatulh these1ibigiv(.M:/modwbuilta@ąAaywhi0 rgbngtechnolog)solid-phxtrac(SPW~varyAdailyatI`5o 90/)aomnP4eekiod`l 200ۂwezed`Џɉ(recordhobseroHoiiatist/fgueJPubjXas!ɅttyAggA-143ogcLean &;ix gma;2Cxr8Lator@oQrurnaɐaeduclaysu>V@.osantou>,.hirhelloS.unhai>FleuGp,ãoauQBrazil,iԘBackgÂ'upa[agnnJ.10, 30ill葨micXҙiies2%ɣѥ=loc'2Hrsomotyl6HchieXdY',maamT)8exaArigghʺP9ǕǦimp'`ggol(TAT)8_phcissfmarketetven?ethodA@hKmonihonthlyndrelsoresentnhealancedcorecard (BSC)fcompany.neindicatorsoniHed,pecifllyho0oegZisorkcaus(tasip08onatiXssfion,sults@leas`8time.ԃghculat0usinglesperformaripromiTATithuaH5U.f(ydelay1igeneron-conAity慨s 9ponsiblecesA.
iblish`PFleupGroupͷxrymxolHHaRH㻣o τ142,d8incظphciϐbngonclon:ϧaArXağcr(ioheir"inuouIen`ragachi0betP,,!BgoQp؂9eSCMbny.a!out͕?e9' @Saoaulorkjnswell-recogniz:advЋXAupo1̌Sehhealpl.

A-144@`ohggRSeutTpCost:*pnegorə1u>S..l ani. VerbiUny,ashvip,N, -145XwoIMPROVINGHEERFORMANCEFVITAMIN12´ASSAYSMETHODOLOGYMAIC-IX GMARICSCHggg>M..NDEu>,΀x.UM,З OO,րORSOLLETO. HHospidasÊshMUSP,ãoaulo,razil, ŠMackgrd:Tpaim9thstudy tovaluappli)ix gmaet shodology (Defh-Meas0-Analyze-Imprh-trol)|9tlarVpminssaypubrrylaboratory.MsGBserumq'(elochemi`scennOBAS411 (RQiagno@cs) .רHZroach?EFINITIONHASE:dd pibilitireamorkprepaSIPOCHagram.co(ici tPtnaevel (CVA1)RcQdeIqr)qutCTQ)upQlimiacceptaZy)CV9%ASUR؈:mÃ(imithdriptivt ډ@eAroр(R&RHga(5nb(oces.aaicapU(ecillppunˁic)NALYSISgpzHdtoolsɪBETԁɝA1)m¡QpȎؒzplans hNTROLMdC5HqKAolihi"0ifyYben0tcпЉ+㋻MH 15O`softwXesп h)yA/orsi@OshoyeЈra)reviAAMchangdone:Jflow,r dgusl#ag0asin؀ s"ő:eehom_غl0orx"lign="toptrdϼϼb>PhasIh/td(%)wwwww?fo (Ppk) /SIGMAÕF??????>EvolumDPMOwq/tPߊ߀'''̬QgGGGG>10,90>-6,01 / 2,12OOOOOO>31250ggggςςςA9zO''''B69>-5COOOOOOb>28IGGGςςςIcׄ''''>9,7780,29:56OOOOOO>156????ςςςςC ׄ''''>6,28h="0pt">1,48 / 5,50

,.€o`,.edote. Grupoleury.A.,aoaulo,razil, A-147ȒohggLaboo/1+BalcPcarPesa8 u>M.өas

1,.opezarrigoGGGGG,)ntoil0Gutrezʆ(ugoׁׁׁׁׁUriׁ2ׁ>. HospiUnHrario!uaWSp,oooooy9AlV mBgnd:(BSC)Pux8p跒obA QpulHhelpqdef88sN2.WMethods:򂇣Hr:pul X234,403habnts,ttendingnpatients,mergencyepartmndrimaryare.hreeearstrategies(showedeldoSCerspectiveCusto,"GrowthZLnQreferr#Attionnithatspond consultHgar2theabo o@reportnterpre,linical@s@SessBBprovidetinuousducڂPyedicinejNurseŁ^Program (inuhforampl ll! suviYyx cn),e`developedioass meaofnsurveymanuiss.
valpuQ(RVU) (ser@gluxrcluJh蘡hu@!(PerhospixGʇt)_sخ@r 9dedquIwheryXuxbil2ha bloodrawng?Glsdo! :cjǻRPfuyX0Xb?a>A-148okggInȩJSoloҠ)mMo8rathLowL!ss u>G..uimarãeu>,.Ȁilva,͞(.elm eCunha. FleuPup,ãoulo,razil, hMκXroduق?upapf8nceOoit_^.iigoHsߧۧgramȜsa࣢formmˢ lolP$)hichKnotenu$(yet.anmѝorequiqabocaPyst2ordovoievilhtD2,fragՈꄉb ,cle`acidx菊,Set9mqy8rQA'pylڙ)rrHtexe񉧼Б؇`ub>,͇i"ތ`sidxiBgggHp)Ǽdi𸜅zf,Cmeais(@ux neqaHMode`oy؟Poka-YokeɄ) (of)Lex&;x gmaȃ6a 72,/yem so!ȇBnnovH1isXrit߾wTbcod*phzbatch񀈼esPca0wayXsicprgWPransPmzipetagtc膃cfi.TuesdayM,u260Q8Ȃb>PoS:  10:00m -0:30mha8 Pzric/Fet8ClinicIheryOW>A-149ogfHareaPnancpssocPPmaotein-A (PAPP-A)Bfreeta-huma@h(c矐dotrop (FbhCG)ifZtuto. ooolu>A.Ȗ`os1N/b/u>,Ûsafara,.izou߁߁߁߁߃Makri2D߁߁3߁>ЁDidA,GcpςςφPςρBioȗepartmemHKATenlosplifihaHoe̯ yrxie!MlӗoUnpr(fτƶF-DpCGGGGGGEa9ablisbTamark ; d,oHBultou(u@lranslpH,!qro(nascnchromosl@nti(fir0mrPk.IdomPmetho(dr٧5=߇߷!olviPcryp e༢(TRACE)echnolog)ˁA:z(Brahmsmbh,erPany)Wimmunoaysj򎪺vsX؍omiAs (MHXthcgn0icsnc,arrytowNY (R (;BH(annmWPA㌣enzyme-lab!luest́whichuI0`(Elecs8spectlyntl݉naewx0ibAiord8tYign@-m?s߈aimයourtudyaȜvalu}v2000WU4(welX3oldω201;xcomisio.ƀ`eahɁB?er0shum9ʟ,tHnwwwwLW earg8rs)oalculiP0QcorCcoeffici! (r),lopincepبir 95%Iϐϐ̍-indepe(hve3`sh>ollowTr ComparedethodSlope>Intercept777777>r777Wcolspa3"wwwrFbhCG8GςςNewiemensmmulit؉WWWW">115ρρρρφ1.0b> (P1-(8)oooool-0.53s-2.8p7ooooom0.986ǂǂOldWWWW>141ρρρρϋ3 - 06Owwww.19{9Nj8NjNjNjǀǂǂRochelecsysς84ǁǁǁǁdž6 0.805oooo92w -5.ooooׂhoooooob>PAPP-AςςϧoǃWWWWoρρρρϋt9P4A3߂oooo.40l0.67- I296ς?ǂǂǂǧϋυWWWW1qρρρρφ60 57yGooooo X44wwwwww97ǂǂǧ߂~ǁǁǁǁdžu9?ooooo.0H43!2wwwwww zr/tablea)??<Ԋnrecbrate/-ssayorЦeemsowoengrentthBrah8Krypt3(slope = )mparHo/whicheasu`ueslmost 40%ower.ansFbhCGreoІggggay.Ҕh8rrespondingoobuBlation.G1OA-15*ogediatriceferencenter Alpha-FeProteby 2noAnalyzeru>S.̀a'ulu,.ʌasmussen77776,ׄ*Roberts2>. ARUP0stitu1CliniВRExperiPathology,altkeitUT,?????Deptofathology,niversityftah,altakeÀ T,
G(s)ARange777777>N>Upimithg/mLb>95%IPRIspa6BeckmanorăwwFo6 40ǁǁǁǁǁ96.9ׁׁׁׁׅ4.2 - 140.709Mo5ǁǁǁǁǁ59.8ׁׁׁׁ׏3.7796߄O">1ʁ72ǁǁǁǁǙs.6ׁׁׁׁׁ29541ǂOǁht="0pt"idth="a>65

Roche170/o-11onth9ǁǁǁǁǚ18.3߁߁߁߁߁71.695ׁ6/ǁǁǁǁ9ׁׁׁך8.29 6O ǁǁǁǙ8ǁׁׁׁ׸752.߂3ǂǀOǁǁǁǁlj1ׁׁׁׅt5.82ς 2ǂǀooVg3Gρρρρ0ׁׁׁׁӣ8q2.ׂg-6522ρρρρρ.ρρρρϯ{5.65ߋ/table>A-15b@o?galpha-1-antitrypsineficiyranalwinsorn0thamiliSp`aneousneumothorax'''$u>D..reene,.rocH `,.rautsc0d.aoρυ߁ρ.yonׁׁׁׁĉna. Universityftah,altakeity,T, 2[S330F60T;K129Ek (M6pYuA-1528XohggValidLamellarody uY(LBC)0SysmexE5000eologyKzeru>D.İnberg,΀Bn Rxlock,K aeng!PMayoliFaRoer,N,a΀N0Backgr:ҝior(ynde (RDS8caubyuf{tusurfroductionndaneadoorbity€`talqinewborns.aHatoryestingassesseumaturenableshysiciansheiskorDSriPdelivery.ulmonasurfactantsynsizedpypeIneumocyBpackag inlamellarodithatXamnioticluid.ԀconcentionfGD ǁbes؆termine//.i(1-5 μm)resimi lateletX2-4Q,dardeologcounDŽquxif?Object:o8d@yLBC)`ysmexE5000alyz蔊ompyresulwithosbtadʅAbbottDxLM haXMedsKCordaAbetween (w/albuɌh0w6@iduo sampsubmitt)rouXlinic5(n = 76).weZifu,rozen,rhvisieiumbloontah#JexcludeAutoffa>55g/gʆQ銷a//(0,/uL?='!ٕpredict/Sut-ggܛmΆ<4015-,p;lR\eU8i[HȄ(٠9: ImXcstudesQra-CV's4.6%2.8Ht16,2cA53,9rer6.7 4.0 3,759,4loxtѤt#(CVB 10%)625Ka7.1%kKI(eoPcangJJ-(r2A-153Sa'ulu10u>,.ʭasmun77776,.ŕwRobertsARUPtuCeEri)PalogSaltkeÖJUT,?????DepartJ/nprsUtahehciisOOHQbr)M80fhchild,,8.h+ (FSH)ǵrisptQfirA#n؆yɂby 6hhsy1-2xgirls,egjaga9eЀnQpuCdxsedaPsexu9haracic(l0z؃usgno ay3cociousFX.easXmYlsoeu0@PfunШai^ hypothalamhdisH.%r&i$B u!8(qRoc0D뉁od@rs170szer.ubjsnHgoYelcurgrocedxtМHyC’PXC0wnrXobt@SmioAHs}xcludedornownedicalonditions,ise,rfhearentidotrovides.ԁ studyncluded 407emalesn40rfrom 6onthspo 7earsfge.loodas llectinHserum0attubeallow clf3inut totempeurcrifuged.liquotseror쀸itrogenioxstingnꅢthahix9OJanalysis resulzhht*by`der.hnt脐lyignifhffnc`obHv+/groupDcombipos(re|Hal ummaritablSoooketwe`d.Ƅ耼,ɁQa?ׄi82, 3q4\56.΋ww[wzؕbjٓish.ҀVqFSHhoul,-specpgtfEMmA0p`acfulclinprache.

G(s)APRange777777>N>Lrimit (IU/Lb>90%IUpȆ777">Fo-/////)160ρρρρρ.4ρρρρρ0 - 1.58.ρρρρ7.29߂'߀߄g3-2/ρρρρ0.6ρρρρρ55ρρρρρ4.36.1'g>5-6123ρρρρϋρρρρρˉ鏧-.2ρρρρρ2.93W'Mo/(/////24ρρρόρρρρύ߁߁ρρρϬ82/tableHa)''$ *CI=Confidencenter1ϽwA-15oggPilotssessmeofse9colornsityistributionymagenalysisolHifyesults1thehosphatidlyglycerol (PG)gglntest惨fetalungaturity (Amniostat-FLM-PG)

J.̀cFalls1,.ʂ!Closkey77776,.ǀrenache 2 F.tickl. JeffersonnivPHospitals,hiladelphiapA,oooooftahchoolyMedicine,altakeÁX,TbrH)Nu>Backgrounda:hegglutinati8test (Irvpientificntann@CA)sntendedo`atehetherGluidampleateaxasrexHth@aow-po㉈r`(0.5g/mL).ԅaresultpresedisuyaypar Ȍqdlor.ecause񁈎r|mweakojrel1of(if0H,@xamdnbdistribP0Uobtabymagyalyshcouldrovid`jecmeanqcYrpreonu>MXodsSAGssingit-plineg ,ahs(xduct@p Ȅs.room-tem eryI(30in),`dig|(eXSwacanneIspwQځЃ،nj8-b(0-255)72i8pixelith,(aRn ؃wxf?>shownFigQ(_(yy)-logcumuTfra (xi>bo .8ڀ-'fpok volv `apxtep10%roTx>1`_牷Yas-0Qur(AUCs)ِ@XtQuishgggg`rrr.we0,*xioRx'sgha[ira-ayariabiy8Г al؋d9Qsib(comb,23ǃ׃Вi3Ɨ@ruCAPIyyVa14%'=1.55+/-0.21,=9 Concl0CCPadi'!7}7tw!iwxAason,yi/Ǭ9bsoutoff:desig)Getnoyded.
a>A-155okggFirst-mefnc va艁thyroi0un+ˀeeckmXC09UniCel®xI 800RIRoc0Modrtics17)xzers.u>S..yness<>1ЃiXׅi>ARUPn(tYC izExpen9Pathgyaltkeâ,T??>??Det!)/ UtahσσȂљMzxprePwoY`importmonitobecausbnor`@ЖEIlHѢIldurtc`]neo]Sobj`Jourtud聸`ablImedpHfic(RImIh(onTSH),re4x (FT4"I(`TCPdaTHBRIЇVwqd 2,0909perumampleshichadeenreviouslyubmittedorirst-trimestera0nalcring (mediange 31,eeks灀ation 10-13).Is134ealthyon-gnantjectereePminH(91emales, 43(R18o 64earsf,29Alamp뇇ɇkroglobuliutoibodi(TgAb)ndCideroxidaseomPOquspAbbottRCHITECT i2000<>SRC@ndžI ㅙgcЈɍfewithcRRea (tableSignific9diffncobvetn>loHupTeb4.̂7"rei_~highthЈiGE?Y/eP{Ֆ:compvMӓɌJȜ@saryWfun(1 @\cy.A-156ЁogcP)ю7alu)xmJbimlLG0au>D..osoox>1`/u>,łw,Osei-kyeӶHmenga-Eteg,.ilsonMaham߁Awini߁߁2߁߁؍Adu-GyasׁKaya߁߁߁߁Tchum߁߁߁߁ߍRpaP烹Asso߁߁3߁߅Owusu-AgyeW. KintoealxResear8C!e ,s,oooaooDodowaGGh7776P77Noguchi`mori InstitutMY,ccr°-wBackground:uHimasablishge-p//////hat betati躩screeningitxld rtici ЮQi:erumliromp nthy<1p (n=271), 1-4s422)5-12485)Ѐaly%ala(mino@nsP (ALTas!axStotbilirubin,rea ɂonVi`ablec`ÉCstry zeDiY,ԁNerxds)n (50%r)ileˑ(2.5 thߗ>b97߁߁߁߁߁؄sdenonameyReaڋiؘ pS8a 11HPsoft(pCorpX,.S.AccordnLab薐qdndards /IInXoedi7C28-A3uideesutlsrv[aDixAults:m#orachnalytendgeroupreresentednable 1elow:
mOLƒ///>Au<year 1 - 4s 512ψψπǂǂ">BTstryǂπ?oLT (U/L_7 (7-4021510 (5-53'S>423-67321-719-5/TotBilirubH(µmol//|6.30.8-23.2'''''{.9!6-19.5'''''Dp1.7-18.9'OׂׂUrea (m/ (03.60.5-4?8147GςςCtininewWWWW748-54S833-7/table>A-157og`Serumalci@ Phosp eeve#ianÅwithickleelliseaseǃǃǃu>F..otchway,ׂ(bap2Panner-WilliamsGGGGG..ekpor3@G0umeh''$4''>. ȕepartLaboratory,or(Buea0Hi,ccra,,OOOQOOCervicesPathologyt,niversityI͡SchooMhrnILJLJǃǃ‚ɨMckground:BbnolitibeassocXП:s;c9dA-159hohggM(icؐPerEvaluRAPIDPointSP.arnes1OO0u>,.׏0k2Tilh(͸xen-Thpson//,3//(P@olkirJ.etze4Jortani. iiׁi>UniaityLouisvi`choMedicine,`KY,ǃǃǍyǃǁSt`ôd’sȞiPp OGGGiGGAiemenealthc8aѝ Norwood(A///i//WashtЊoObject:o+#accuracyimpreci٢:n=b=* (n)obl`Xဘensby1-of-(POC)HatorvRey:oigxt䭀vfromZde1hemoglo.asurItمidJssessjaЫriskkernicu>\ology:(RP8)jLab 124LA)gQnalyz (ԥarrytownpUSoHfeatCO-oxiryoduHep haHopoY?ys mplop88absorbnonQ9sp.tach[reli`te`e@@OCДj(!followmmdesignquis: 5ayzr8ciIus9QCquadruplt1$correl340v.le,*cinuou utomd.dbutCLSIP05-A2R`9`-IRocu"etodžɆ׆,)lyׄsulٍ3Ò(Yin-run) %CVȆL2.6%-9( (2.3%-3.1%)manu(`91.9 (1.7%-C'!Fa(h-؊@0ed); nBILIA (range = 2.1 - 23.9g/dL)esultednheollowingem9reg sionquatH:P405 = 0.92 (RL1245) +15,Ҁ5 (Figure 1).
a>A-160okggPrevale`Impair@Kidneyunc2HHospplizPediatricЉsJx.ebyen, A.̀erguson,.arg,..׋dhChildren'sercy8Cs,ansastiy,OP/ixDBackgroundsevtyhropcdise (CKD)s(aXfito 5tages8dhcudaimrglomerril1Q (eGFR).ecl0iSchwartzm,YdoFRqcL,@f9Xt8oH჉uhoHng[ologsmrenx  `wmgenebyCtDtistudwhichoXuisJVIDMSndard*enzy c_YZmakit;ꅬȖीg)irw,loȄ0aitroh (BUN)*gox-ʏŎp(pސx 6xnthc!?0;f7htOurgramuto&-fromi-xibuЁ8dmito0i@it(: lle *p8Ԩ7@-betw1-22Њhs htip*w@j`Lh2idahysipResXs:ure, 1512orpɕQge: 8.5{,: 0.51g/dL,:: 101.82L//1.73m2r(>)OOONNumb҄GP|Ag`Y8(SDHcmSCsggf>901043ׁׁׁׁׁ8.2 (5.5_2 (32.70pt">0.4 (1.3)

113.9 (51.2(r8r?:ǂǂǂǂ60-90߁߁߁߁41ρρρρρ9.4 (6.7O[28.1 (300.6 (0W79.8 (7W/W30-59߁߁߁ߌR7ǁǁǁǁNJR0S9OP53gV0.56Q8.6W/W5-2W߁߁߁ߊǁǁǁǁNJS.0IW9.74Y1.822Q4W/W<15焒R3.54">8IOI6M/table>A-161Pp@oggCystatin:lectionarkernhronicenalailurepediatrpents.u>S.aparrósánovas
,.ermudouitarte,.érezonzález,..arcíaeeasilva,.erchglesias,.odrígu`_ހπV.ӂ(chMargalet. HUVM,EVILLEHpain,A-162ojggComparisonfotal჈DirectilirubineasurementsmongourHffernalyzer ߃߃߃L..cott1

H.1Lee40u>. Dartmouth-HitchcockdicC(er,banon,Hxggf(ggCathcManchesb 0S1ernewampshospi(ashua///+`// &;āMoo8wH,Bbr)MBackground:Љoghyperbemianeonatesanes0acutevencephalopypmanIbradamagePccur+rtovalu0is0efoessi@touidelinztreat;evWSʃVdxh.׃׃хdnayotorrelwi obtusihaVe.hcoulgatively髠xiZtransYbetweeVcasi.bjX:׆im؊eɆatytdۇ;fGspat(re܊ @health[ym,woohutsYc$]c04bartâXTs/medJrPularortsoft@Kpfacyfollow-upQbeɗ)#irmmuni0>!s:gw߇each :@ifllhRohnsi0VistaGG0.Ҕf~–sZo,..×(w8a=eXregJBl0-Altlot>:́Ղ!erci`wison{l萆abl.cB Hgggggb>Dsoo77 ModvsOCo@ 6000y = 0.9673x +P1091'r2耑X/iz985/Aver%B3.1%wwwwwu1.0265x -H027wwwwwwu76/wt-0.4//cc111942137'''''$92/'$1.8ooooo508Owwwwws770/w10.377g`ooׂׂׂ׉729s01/ias = -1.3%

y0.972x -H02352 ncluIs:heregoodrrelat1(> >)ndimited(<5%)orotallirubineasuretsmongll(alyzers.Ɓdirect,ggggggggb7)utri)l0.4b`most.ل mpsdataanerve@sefulpolclinicianshenWpec difftes.ڐ1 A-163PXoog`PermanceŘuofinolta/D)rM-103aundiMeterOOOLu>M..ush,..iley. ProvideASacHeart XpC PAML,pokane,A,In 2004AmerncademyPpatsel@@aXviڈirÎZPractaGuM8gHyper^emia Newbornnfa`35roWeeksGe`,thfocunduciiincsee߃݊ǁphalopath@Buxbg0sessrneonate’suArcutoG(TcB)hi non-invasimethobtaa.'OBJECTIVE(:2Tg`agrebetweȀcrib-s///,erYlab2AbbottrchH@ci8X(QPayhichtzey1trophotoX0iwavng@k/ETHODSNDailypor@resulromwprid.Çi0(nsT_jtakЃ^lizH2ourfɍk`t#ȅ1eheadinstrug<@3ad薐 au8y30 MosYqapy[exdnstudyoESULToFM110mЄ&, HoibyHnoabPku 1?dEPorނEg-H 13.2g/dLpz0Z1]0s*"s:Ӧe = 1,pt-2.4XorhCoeff(=45 gbnh6.0 ± 2.8 (1DOD4h@3.3Dddilevaluatedccuracytifferentevelsndou0that,verall, 81.0%fesultsithin ± 2.0g/dL!theabalue.b8 7, 91.4%)a892.3 meterWGWU.
>Tanufacturreporhi 66f 1.5.nistudy, 61ǁǁ‚rang0JM-103’serforpcecceptablyloseoSrclaims.u&positixslopenegainP,loh,ℓhow(readrgefromFBilirub؋/p>A-164 ojggMETABOLOMICSNDRINEGALORHEARLYREDICTFIDNEYNJUR9EALTHYDULTSORNLOWIRTHEIGHT (ELBW) u>M.ussap1,.oto2ГAtzori3Barberin0.ravPuddu߁߁5߁߁Lh߁߁6߁߁FArgi7Vxanos߁߅߁. DepartmyLratoryedicine,nɟxy-HospitalaGenoa,<ɀWWW(WW?PaatricNeonaIns CaPatholog(PucPstitutpO)Cagliari,W7775x7774ToxicOnSolearTqdiovasNeur!icScisĆ>Є׏׏׏׏׏׏׏׏t7777771777׏ԏǏǏǏDŽ㢸ׄׄׄ br)Mckground:2metlomicrec“”echn+whichAdefXdsQtheuanatmeasuresY dyna1mpyaؐsponseAlivingystemsop)physiޒH@irenetodiftion.xrordaeample1ciderKas‚Hgerp؏uPtertainoimWereviouslyhownBPfbetweenpa24earldohornithxtlowirweight (ELBW)bpproate扢QHXage (AGAt.ԅimpair+fsǗǿH-NMR+rel(dmanywaysnvolkidneyjury.Ҕaeyomarkhbssoc‚:GALreأw ypمdlё, (uAdama,Bs,aBaimBfur6!s._Meds:"studX(mowoݏ peofroPĚnWh`SanͤXinoospl,enoaP;if 18Ňx (bl󊈛 `n:)`hi"e3 (n 25)._ѨبeaHaHya 500HzpetpaȊ1nubj錀ivPsSIMCA-P+oftw.iZdyhemilumXs@c ,pZxaully-aut@q򁐝`pѝRCHITECTb(t(agnostics,ome,T);heutoffas >130 μg/grinreatinX.roupsretsticallyifferentnNGALedianalue (p-J= 0,004)
2,20-53,4).ÅPlon:hisudemons ȎaPevaflaiomarkerhichay8c0ubclX`athologkrocesskidney.

TuesdPM,u260Q˂b>PosthS茡  2:00m - 4:pmXa8 TDM/Toxicy/DAUτ_>B-01g/_^DevelopmAareehenyto assbyoPSiesDVIA 18xTot(Medwwwru>H..Ҕxard,..achmann,ǣin. VirgaXmweal@UniityPd,A, (kg0ndIqpb8i-eppprug,5,蚚narrowrapeuQZdmh_t.Opxim؄90%ⅱserumbu@z)un2,r “f”pmaJact8.Ů׀xommurtsbA ccuAi ibvariouڂpessequHldit'Mimpor.e`؀`yu0 sym,RsS(but)vailable.ø TpaB⋪˔ 750 µL#sspP:addsailli8eÓiYM SpXFilI)ifugt 711gYr10inuiamb1emp t@b`dfurax0ng8ecaQã`SߓMdȃsi*Ϲy)ix2inٖbsampleolumho 16La䁈g412ILHdue 2-fold}ʕib؆PabsorbZpa8orkGsyheh8KvpuЇ/(≥ 99%, gman`5HMeOH/IdH2~/a0c0, 0.5, 1.P2)3)4.g/m PXiɀҡcy evalـorZCLSIP15-A2.ine遟6-A.ƅerf 4,poolth( tapy/10mnpi9exoة hemolysPytaurobilirurpid.ɆonjXmooh7ǥResultxCVLoQ (t)10%VsZQCp`iaψΐ2)~4.8(4.40lComisӀi33}&s (S-AbbottiagnocsDxgaveeggڀH:dvia () =919ۂx]0.0621Py.x(0.95%IIjceptc0.91.23-X2H9> ha裶#[/npp>J.9991roؘ*(iwW???W>0)zHT1aυ;i9b2.8Ad90g/dLe-?gl`pқ`<3%ias.owevereЄjugҟOၰ:+38%ʈP`?toinoncentrations. 1000g/dLflipidesultedverageiasQ+18%orllhree߂
B-038Xg`__Potxiitfs1F/M{ideÌ ifug*empt@߃߃߃u>S..ruscott,.appe,.aniel,..ort. UniPsity LouisvillghY, objH Rstudyde mineRePoolxZţm,uptrolaё!ficcestw>thodDe-ȚnɒCΎmercY''!0)oٗ0 af 15-ut_Ye25°C10H.ƀXsomw`imulXechӲ` iXgЎTdoHstarrNi djuetoIoullowщлq, ,diئhloaጵg`=15U3I` ojRoc0COBASNTEGRA autoPnalyzx_nPagno8c0ag!pHhichxohpolarizmmunoassay.'R .esawreco`yromIyp ɉrX2ςyaH@ncs22% (ranh11-47%H=12).nugc27o9-34%;h4`P߂g@႟h3127(n=3űb8vϣΓctiisignciWilcox0d-pair؅(p<0.003~Low ducxzdexceeY3DЋdatar?WɺzvcW19x㥩i`WzKbeunnܖi0ڃtim`)previoue"yrÆhel:;?Clusy󤧹ߍVdurI΁lIoϛjnten1bynouXoϜ2gߊ@sumab(duz rix³( m 0Аp {lؒ3*Hr?/@icaHumoniedPotitf00de (1)ail!yZs‰oHy5, (2uыzҶgf`23(qnsoHπ.Ãa)``ڵ#spec!addlabo8oacdiБcklhtheollˀegefmericanathologists.hustsdvisableoraboratoriesofyentHutempeur theirwnccord.

B-04gb__Ultra-fast,imultaneoAnalys(anelYBenzodiazepin inumUrsingnPE-TOFysoookM..omm,.rikh, P.iller,..aMarr,.zbal. BIOCIUSifeciencesakefield,A,13Қ :easiaI?aHciyva鐷㔌`o@Anggenٝ2develop@ދlmpQutrorunь@pl蒁sdayeblish؆!`-@cisޭacyem!aЅex,a0ne 10nҝGGD2??>0.9998l quantit{rMpxim3Gf(%CV)yXh 1!YX15% 𭼭e{2!¯]0vigyu0highynam+ق؜҂dҼhimouё߁!8Q?WQMhextogiӓ(ojdu>osbtaȜ3؂타0`'FDsR/MSHoww;H20tC.—xdUipbvaluburꀠid.WCl`on:spǡtviI(ߖ'cy)hichlh=l??߂ݙةgullsHchi@hH,spehegmȃ useful3ffi0/fcp((.B-05Hhg`__Mbo "excP@ppd虵byc0bd rmabertrugysm&a8 __]u>A..esceWWT1WW0u>,ĹX.eW,ͥ.ug3Ssǁρρρ,ΟУ0kat.eni,ҖptayBBl>ˀ3. <9<12GGBUnivfalifornia-kaggschool1Pharmacyndmeutical0iences߄߄߄߄܉Ȅ߄߄߄߄߄߄߄߄߄߄߄߄؃br)Ni>Background:*Pattsnhronicpioidherapretoredord؃singiautveznurineruge`ng.C-MS/MSalysesnndividx〸alsoeasuoxpmtaboalow HtinZ,uasph/hydror,ycodh߀یQoxyP.fᅮdaasHf҅Eco (䇑bymolarohntns)pairsssPlish@areathpopul,sintAP0expecrangealubef8dusHtpÁPriaQal’ Dsma8if@"ov`time.Wi>Obj`study:ow`/f ?z',Aha[qcsoprl'Q@ods[UfH 250,000Nsamplsiw@zk/sreviousl ut. (TDQM 2009;31:746-748,aPhysic0.10;13;273-281  13:71-78)ultsRI71su74+followh:[E/ǜNΜ)EDDP/mebam/wshow!Gmghndex="65" ign="l("eight86"dth="377@/0@p~0pt~aDiscussrז0ropoPؒ8p leQ򀬋anner:fadminisĜnyclXYr K /ul آf@95%flimi:W.&Іtidec󤫅_aseksequvis߅WWWtsCsoruLp΂lookc؍h///,ro r%takailssms0pɄZeeph@aa-$0acB81os l(q._1geb>B-06g__E musePre:Ř)WMTrakmmunosupssaXEit*ꇁ .wwwru>D.cKe<>1,..amhd''$2'' oltP.ooper. ȁׁ׀Steorge's -nițLPon,EKdom,iChoc,ncherGFπ(Background:ԗTORhibi,&,Indid跍rapeutbȁɕ(TDM).eflXuorv y㳨ica`ɩ`9cliquidh8atog hytemss-setrh* ()*@.̈Hپndardisrefha0 pa?in-00ibohaven8ghhtwopѣI-betw-cPbil.Jo PSPstud(o";@â(0C߉IquhifyW bp0amplhf(Pncac`ansprecipQs.Methods:Ѐs5-Day),nety,oPdilX8accuyndoˀtentialnterferencesHvestigated.ԀangasXormednheׁ rsCQUITYQDC-MS/MSystemndethodologyarriutspecifiKit’sirectionsorse.rote@pipita (200µL 0.1Minculph, 5acetonitrileontain2ng/mL 13D4>-everolimus;nstard)ustoxtract偗fromhobloodlibrators/quhths/pXamplH(5).h@graphyaassTrakDMÆ 8>lum.1x10mm)t 55ºCithbinaryrad(0.4mL/min)mpris!de-0iQwyanol,ohm012mMmmu ؁Ғ0%miciPositivelrospray郡 Wo9W (975.6/908.u>,926.4w 81914.3TotHruime1.5ins4curPPstruc usixon-z@p@8-32.5H1/xinearegress.䐊astudSҧ((n=50;diacnsplaPk1ѥ2B-08J.Njr,.ilx,Ӌang. Cll1шF,,H, B-09gb__Comis؉SixxtD͇2s*Emergyoxicologycreenwwwtu>P..yle,.ooth,.age(J.iSpar. Unrsity9Mippi dC erackp,S,techniquahoul(eployweo08.Ɂwork,xsar@{iviashromatog hy/mIetry (GC).ObjKshńхstudy8de8mthblxTsiڌRabory’u` (A)≶(irdojimoto/Ck.ach݄evaluꁉnumbdrugsc,s#ic FifQaXc1`nؗH-idifi@spYt -80oon(s耧 oQ"8slu‹study.ϥseWWWWW,hXls18.5ZrB.


M..orgman1,..inder,.eynolds 2G..cMilli/ 3R.È@endleto4Hde,.. UniversityLouisv e,g`KY,///Ƀ//PGXLaboories߂߂߂߂ݍ߂߁ARUP߂SaltkeÆ,TiUtah br)Mackground:eaXpreviouslyPerMIT:(Ktl., 2009),harmacokineticodexgoolhich᠊schang(Hilearaesult!fromepolymorphismhurposeQttudyaseasur(hSA-wconpXprospectxe@esincyetweenctualndstim*.?Methods:p@xz0ghsampwePtnuHfirstnth#erapy:ea@obir8HPLCssasde(op/I;wiinter-kCVes( 5erBxrolst 0.250.5g/LabsolupagreemESWWbe@uꃨaddijanalyǶ9py:Hȍ>XO(9(w *1/*1 = 16; a2`8[3X5)'q8t8281-, Aefrequȣ0.78,014hJ09,q,texwCaucasipopul8ashUJaox55%܎vЄ0e2se63.4ׁZlǓuByotyphad 66.((n=15874225P27QGD3B72.9B48(limit (topnel㊰X).n 8@Hidp)ڎpш(lorlf-lif))qמ-hinfX`(bott__owr,m`maCsuo 77.8%'?Plldښ,jaccu8IHdi ady-st1u>Ålus:bN? mRXNJKmyxceedp8ahOOһ׹3S=8Ta(upporxuWTXi!ݼs-guXd/\. (SparXyRUPabopor NIH 2R44HL090055)

~Nǁ1σb>B-11hg'_[A lq8 rooghy-temYyho+quantifndrugliimpnagⅿu>CPeloff

B-12A.rozco,ʜ@guyen,½ooHK.arValdez. Diagnoss,I,unnye,A, r`)Mackground:!(MTX)ljo yfe adi2\d1Ӕmten9emapycymphobleukemiatnonlogis@IQdrheu@arthrrsasiWhXbЙ9 (Lrescup-b (HD8;b1,-339g/m/a)suwxylo(d.v.8fðZePcerTNJNJ,mPeosarpbhs񂁞heHneck.Ȉa p)norЊཉfunc2byigoXshydQlkPnizɮ=enhsolubibH.erum,Hy9 0 µmol/LmorhPha cokᄘgxLV(itygr'reH%rpotl toxJ.accHtt 0.05H!Idhr0Йs-tatus.OBJECTIVE:ŷ)XQas?Assay.dsQRK™aomenzymeHmunoquy xhnTma.zøAehnRo/Hiti 917ym.ncYArreisY=8!>sixplib䍰vp0)1.2n)ix-j.07,40108, 5.X5`50Xɑ*@tЛ`unǍΐՈЕeciimi둀ne@YendŮrfp,p0fB,YympfromHXhÅidparisono ˀAbbottDx3)singЇAB`okgj sisLJAclon:MtrexatZvidxqvhoݍJpla RoH/Hchi 917rrel8dAVɑPhomQeYenzyimmunohnolog8ell-su d routh M]utom cX2lrato@syhm/peight="10pt"dth="a>B-13g`__НormQHarmoMSɇ?jEmHODULARs8苣bc501S󅯅u>S..ib10u>,ͯx.ainzeW????,ê(.loriaE.cNerneyUKHYeo. UnrsIChgodbCer ,L,A }Backgnok8snhibi0prim0lv`)organ jeXkidrans(alsoatFdvd(carciaaapamyxv څTsmitarge(mTOR)h`du1rli*dte‰p `vivo.bvestudyxamhdz{p#newѭipeӠ ()Wdlopby=StiȤ07ist(modC憫zerpBs(upȻebetweerug]{ꀺcojomi(Qbobind @ttabse\߃,b-߃ٕgglHSti-gwY+bsorbchaqܜȼhometrly,dirpo8o񉰃B݅,s8,c?9(d0a5ed,lowdowWWQ.c-dependكÂYcur@c8bbwɪyeOl?I.esultWithin-rucisٕAqd8threef%quȯ8XP (n = 21,Y4.0, 7.8:15.5g/mL)drom(15.8%Vꁡ6.710.0.œ-d(owdreplXsixwimoН5ji6X)hvidedesultsˀhatangedrom 4.6o 7.9%Vor800nd 11.013.7c501.heimitfetectionasvaluatusing`rials@voideverousJ rminxbe 0.43g/mL.68DŽdReportableӄ777known/soncentra2analyzineplicfourmons8t0lxcoixaы:72J21%(0.7520)610% (1.5->.omparishresultsSp Xpecimens trmoetho@nothҋywianC-MS/MS(n=105,1.8-19.)as)-B0okgsaeq0I@y=0.88x -0.08 (Pear’rivXr2B-14Cid,..c0y,ӂ`.itzgYd. Rhoxaboo,rum,niIK`domP/ir )Mɳoduj_PPmajhplЊɉсusedve,xxgacelaxtlorhlffe (6`s)(1-3,h#,StQ,Wl~cheduIVrugy ll9ubstscOso ubj fe`P Y1o/qrXrPlync `0s!iicasework.Relev.vailabiyys((M8MhqtBipurposeWp,oiewwωo!hhiPvaluH`eset9s!Yy.e admin)Hheep1a)thba videarget-spXcЊis0gG:exHrom-ZlviaJetoXbodpPoɞڏ(platR(9mm 0)?lsovesselreѲ p(miluescyq@.`b#jm@etweqHnhor1dishoxidabPjugs-auto!HŎYIn8ti٨ٻ`8焁agȘwiGCQResp҄ВL̑,ᬼ%ross-ÿX100%77 57Û/ cnh"K_ZIC508.2g/mia-cis(n=6@CV<1diff@RaPelAʣ58o0blood_P72(ikPd/smLshd{96@!lyqclu ad؋ɘ@applb Ats!/$ OOP


R...erona1,.rm`an2Dungׁׁׁׁ.molX.lȁ߁߁߁߁...u. ϏGenerHospital/C,{CA,Califor0eroDivis(DŽ/ 2br؀)Mackground:taerumndrinetestpϙϙcuntly8plo mmunoassaysMS.Ɂs,owevsuf ropimitxpecompsyn*l1sensitspecific Uprovide蝸utsna`ˢ.h haGfrequ &ӂh//rsherenoutorJinxm󄱇!Hnarrowowyalyt5apYCeC#dv؅)m cacy,solؓȉdynamicangliqui`hatography-ime-of-flYy (&)velldtPu0bbothAnon-/OeatumakYpdexplatologMethods:גset-0axpid,Aic,:"msi“die--shoot”rcrashπɗte@prpᑲfXjb׌18Hlumn8؀die (8킰ruP)YAgil!LC 1200{c 6230elprahonizonegȀhpolarbTdataabzjMHuoftwaZdospbpiaf-tol0 ≤ 10pmreQ 5000[^70 (nu8ٙHP8meassotop0patns)ʄtIbinゐecuPmH8tch*@/Xb8abobtad+yPvailablر{`n)xqusreportqsumpbmPJ1ՌsameU툉$,5sosemi-quИv0W6844iz-inducAs (SÇnel):205iab@ (DOAfacIarinvolvIunex4lmXHlau0twostym8ȶPCC .qV t8IYn± 0.15wxaddearch؍a?>Rlt`over-ur ({҅O﬚A1-2hCdevelops!.], xampLOD0.5-20ng/mL,nȇPؿX-, %CV3-12%8%"|betwsj`Hlt%ci70-105%.imrphasHW mюl ѕregaat 2-60ol8yua"1.ap0aʟ8KY`>7X3 55>ѤӀSanƯi:la@yʘ`clude 9eP9qdo8whiH5suicih񨠁5li߁, 3(wsig4xauduel 288ڬœ>Ölon:xceptaarroynamwsith ˀrapidurnarounXimeanestablishedsingC-TOF/MS.ombinwithtsbilityoacaateon-target`screenP,_akendeallatformor`xicologyfmencyn"ationseferrP(theCC.

B-16gb__DPctAPromethaz@se`MdoMaenancXopu؅8yiquCh atogHhyandemssp8ry߄߄߄u>T.oochinda,.h ro,.ral,.ynch. UCSF,ӋFr@iscXCA, ofourlibئbetw0J20g/ml ayeaYrang0.625 - ( (R2=0.998)0.16L93limi detxAׂԅ!,3R+ׂIidpisell5-1Ѣ璑612-14% (twe td: 3R9񊽆͠arryobserv `!ow94p4butAgthup靀>ApXxielylʳO ccéЁ#SoЅi`aboliއ(22 (22%)MPfO|slppo9r[P:"a1orponddem&Ha 8luagsex,9Hitycnl hisyPntify`yм цS}RxsubjXgscnoTOFhX0drugHalso 3`vale8t@HpuonøPlon׎9dAopobustosL/1n{.remiaH-0qSanƦcoLjHospitugge)Haastah ɇH(QPa.ǎHSpohealriskssociaЃQGplay[al8(fullXticrЃBregarؐמǂ.

B-17hg`__H-Throughp AacimusqWh loodsUl-fa SPE<ˀ/p>K..chlicht1V..illerBIOCIUSifeiencesakefield,AMayolinic,ochesterNbrP)Mntroduction:ast,ensitivendccurateherapeuticrugonitoringfmmuno8pressantssrPcalorransplattare.0anyplaboLC-MS/MSethodsyanalyshaHreceddoahyswusecauseirncreas؈itysele.owevabძslurnaroutimeompxo_evaluh@bill0-f`PEsy`mazacrolimuHnholeloodpthuch(sampcyc0imilar;pM:͍J߃AianHstars(ycerpȘ8dbyqQpalib6(1-50g/ml)ː[Pbovineood.ԌjP500 μ=mix wȅdcipitRusa (0.9M)ulfy!ano(ol@@c0aȐI7H焒glŷrifugeFol񀾊(upQ8zfera 96-wellliSOٔ(tjP9.5 (`-5RapidFi(RF300)cou@$QQQssphroer1 Ј@yllumne|100%etyrilDHwamRFتpeg«softw ThkologyapabZghpu`>370^hourҜ+:ۜؗߗކњ merci0vaqu؍Lrun1plxAseQYdز؂HishȤs!-@sOchThad ٌф15؆effi tvarixЅ8hp%PpBZɳePgexcHaCсPasu9/@R~cr99.º(ktRc$abc/]$hannxfǏsig)dowhhi:f3op601(DzƖp:p(X+U,ۜŵяba(oxim@ 2 a熈Pм0furRidɏÓl`:as,!Bsq־r{xA!YjyWh'musefulۂ:&0slcHU(pȤx>b peight="10pt"xdth="a>HB-18gf__E 0SyvaMIT®bMi0icsRIAaminopAAcob c501r,#isoocX'!COBASNTEGRAX800ygggdu>Y.ڜg//,1//0u>.aw,.acDod.anρϩׁρ.˭og. (iX׉gi>Chilˀdren'sospitaloston,EA, 2B-198g`__SimaneoXExMFNucleosidIse- nscriptasenhibitorsu>PXravisano. NjalewisheQ,enCO, Table 1utAsertH؍(tistic fRssaydW!arityap 1g:10.0 µg/mLo p5|,(e㊐quantvelea*Aconhe8fidrugsXprap؋bmethoPИorexgst 58monuAь.lugh/.Ano̓qingoccuateg׈ydesirpeakʋ newprovhistime-eff(Limulxeous⋂.


P..ang. Cincinnatihildren'sospitaledic@enter,Áv,H, yHepcitoringqpc"nhelpfulQphysiciaQnvalu80icomplceth,8vidguid2a(-tol`tىЊadosdfya-iaZwh(g0ly.erum gpKmeasdh-permliq@hxatog(HPLC)thnȀmulti-stepPpxnxssaȢIe!.reuslyȅ@w9CItrefe abQh0urnayalwayP(sfivip {ga, exlaggnehauick놿ʋHrҁc-PcedPQmpdlopaPp׋`HX@Hbs scribdemiɎoȑ,(100µL)vortex-mix@R anoajn)tardenyl@ylmaam8 (3ąy1inu(1:ifug+10,350K0THtoomma0esuл (ca. Uns)uto;rbAHl1inj؂`dirHonsyXhSePjswf//\Lbuy05-µmicro8b-MVȰd-pe18lumn (2x 4.6m)3`bisis9hosxbur (pH = 6.9, 0.05͂,rHflow9 runJI.8L/;Pt 50°CeakWWWWW200>Ң.ane!g1-g/L,`i(coȞTpo12-4 jseizPtrollimi20.2.oin-betwee`cis!threQds0, 4 8)gp 7%.y i@Rge95hNo[)obmЙad@zXieppsu9r8doncarbamaz`yysuxpfeltmoX0hoxobit toin,f0ktopPsval`acid+zHX)[܇чy{assa530s5)9KcolKsh9s.04c5[Zn r94ØXlonȳXvsxcellAreduci8ityPe`oliMex KQeptezӏoh8ghy_љ8oo˔.t9suroaɩOM/p>B-21g`__CEDIAauspplвeråDiagnicsITROSӴsu>J..urak@.rmoisScipc,ret,A, GBackgPn (FK506biopВ(immuupssiveunctionˀsrescribedoratientsithidneyndiverransplant@on.herapeuticangef 5o 20g/mLnholeloodsenllyecommend attardiskrejecMonitoringtacrolimusthAmporteffvesruga@vKnalrPog0h.ԁOrtholinicDiagnosXsITROS™B-22Ёg`__DYopVal-aͭpromeɨۢQu9tDocetaxelĬferumu>M.rzinke,R.reaud,YHarlan,ׁjClarke. Joh HopkXxqls8u9Baltimore,D,1B-23 @g`__D Rapid{ve/Semi-/MMpioid(GlucurȸpPabolih߄߄߄u>J.ickon,..aha,ͦ.agano,aN.oofnaglUnprH*Wasgton,ӿ0tle,A,B-24ȁg`__AȀ8S 6-AXylmorphmmunoDctHersewwwtu>E0nson,.ernesr8SnydBrxaWozHotal,osA, B-25gb__PERFORMANCEHARECTERSITCSFRKIAGNOSTIQUANTITATIVEMMUNOASSAYOREVETIRACETAMNHEECKANDOMCCESSNICEL®xCYSTEM &OMPAOC-MSATCHNALYSIS(u>J.urthy1,.oisclair2N.essimian. ThearrenlxtedSchoolBrownniversity,rovidence,I,MemhHospitHxRhodeslandXawtucketTYbr)MCKGROUND:evetiracetam(-)-(S)-α-el-2-oxo-1-pyrrolidinej]sedeneȝ)antivulsX2inZeddjunveHpyQXreatm1 cPaypseizur`peoplethpilepsy.tmar``underaname(ppra®./*enYompimechanism(s)yhich_Xex؅8 AffYunkn.wr,Хsccauc0dZs,clugizzHssomnolasniaeadachbehaviloblemde(onsp(Kan0tl., 2004).Ԋюeudrugoni9GEonhslaympohp aidQmanagep؀XY 71xoxic@`sues.?OBJ:ovaluH#[a(hateriPcnewCiagnoےGAssayBeckҊocc9Celzsystero(@yqETHODSqhomo ouxmmunoaꂀ!qu)tȜrmin-nuserumr!p.ד 󳰎Șrixe@\compsC elIenzygluc-6-ppihydr a(G6PDH)bbodyєX0łkivdecHuputoڂ6sat"O󆟆bIasp;l.ĩڐohzȄucleȀ(NAD)I@H,xsulbsorbUng sproxtPtrl'editlyqȕ led))ÍRhnonfeHbecacofronR b0L(fr(LePochsero)Hs1wH pڞwwr600alyzerۛ{IibVqxocur(01µg/mLxP}͙ˀQ0îlimi*nearp,@NpHphoolNEQAS,K)f`HHЅ_rcorrelstxLC/MSptH򳘧wESULTpP]ri-lل97.3%V (7.9, 6.529.57.89.1_L]Q_n (LOQ):2.ŁaDsIPa[oفXubs0 (Hb0iluru,amma(obu,x8ialbu,Hxhglycde)QobhvqܻeߘId.ecoyxiڎspik11.0,q3vhowXaptab P.בwYdo[50}r1oo 6`rreU&8hotist¬c P8ABokgؖ =: (Beck) =91X) - 320.95)ONCLUSIONgϦesuHi׿ԏ'ĭӍѿ*(mSy8mYk]͊ف0well-suited ˀforoutineDMsenheniCelxC 600andomccesslinicalystem.omparedoC/MSethod,hichsimeonsumingndxpensiverrequiresighlykillechstaff,ARKevetiracetassayaneadncchemistryaboratorigeneehsultsith@30inutes.


0M./20u0V8uck3W.olt. Abbott̒s,Park,LTRogosPInstitP,ewoNYiSt.eorge'v.fon,EtK`,zbr )MBackgnd:urre0immunoa `t4smo8tc@i螩wholeloodQXograftcipo tardXdue)lPn`nXy1ogn?feceriZЂaimsaossne!/Ѕȋ͉: 4emberoan(2-Hng/mL)s bd23W14XuH`0bhfoHw9((n=9)ARCHITECT17SiemH/Dadeı@P5)2Miics).elecw4lsoiedlib"}MHTrakit,׎orp.T=freaPNЈ1valu򌩊ニbtaiddnIdesig Ivi9X/,R :rang fV)serѷ1+ 11.4-18.7%; 3.9-9.55.0-48.1%;@ٓ-spCRugAtWWow=3.8-8.9%,Pdium=26.0hx3x3g`2.5ǀ8.69)6-23"7.6-13.240.4bibetween 4^K!ameliimplt*1ؗrt?ncl@onSgavhet8 the 5ĝۦÒl.sdidhHgrevogGGH1quiqordo[0optimKrug仁hscуQ9splaglob1.B-27 g`__H؍кghpu(y )TFC-LC-MS:reak2000as/sy0m/d!arhrQQuiPC Toxicoy'''$u>P..Ȝ,.appolpS.ee,.rawR.NJ0t(i>Labur0gton,C, +.1GŢ-d_jzcet:X0benzodiaz,apopiIȃXg` ڴctoxiogã@l:u!#?ystemѭ9cn(/ir1q񤠃ηqpў25nu

B-28g`__SiqHIfߋߋb(rp MDMArugbusuxbloض deEv0XochiprrkitsoookJ.āgh.innega@F..e ,.olmaA.enu>,Ҝxc`l,.Fitzg`ld. RXoxaboZ؃rum,njKdom@/iP4Backgroun77777`TCAs)oooomsxsp+sQapeXcopoo@(t`TH!hdi EtynowcXa limiYcz(s-0ĪsolR(whi@requiargesɃWcut-offʄ0mX8Asub-optima0ixtHruppؘiochiˀprrayechnologyrovideslatformorheimultaneouseterminationfCAs,uprenorphine,DMAndrrugsiabuseromHsinglamp8uyatrix0dicatedits.Ԅ8iaturizacimmunoassay@3this텨i-analythlp0ach,educhvolumeulreagenttestincsres(utput.

B-29g`__EDDPcreeSuperiao͑!doCliaMP8Tprhr(cDŽDŽDŽM..nyder,.arm, S..lanson. BrhamWomospi,ostMA/iȓ̔Backgr:aotRgcat٤8scribyt)Xtc4p0.Ւ"J،frequerpmxLx/[ndiscloPparXmmunom’s 0rtabt2-ylidene-1,5-diyl-3,3hnylpyr諈),alsug𐡆POfastzer𵱃tifXwhopikJiraǣ'bjk@fŘ1canplah= reblXA_ᇉJ̑G@ods:1247`nsecp(S z777byighcsoRI:rCEDIs (rmois)Scific,nc.)狀lympAU480y@ (BeckmCo30YdqLutoff`lyha?t댢`GC-MSaorIimiƒ;plςʗL/repˀortingimitf 10g/mL.
Groupxb>M25(DRI)߂߂߂߂߂>)CEDIAǂǂǂǂǂDžGC-MS둆(cwwwww77MLI/ggg///I(n=577772POSρρρρρNEGρρρρρ3406 - 28475Z0 137Ia7GGGGׁρρρρόgρρρρ1161otermedGςςςϊb3GGGGρρρρϊρρρϓ'"06276b/򠿂'"1/B-3g__AnalyticalUCharacterissfAbbottrchitect2000irolimuȽ:ühaonsthiquidromatographyndeḿpetry ndIMxodu>Se,.imenez,.˃߁߁߁߁ځLohn-Davis7742770G..cMillin. UniversityArizona,uc,Z,߂UtahealSciesen,Ӏakpx,TǣBackground:0b>,lsonownapamycihRqune,acrocyclictibio#imHo(press8ctivYtha`ssedxtenlyn8drganransplatiYalongor/.drugs.ts𞰅okinevahsifntaminddu؃(@pppe1correlat`bloodnthxmaXptprhhidorxeu!itorovodose-mftPjP oHtoxicP.ObB9MŽs:o(ort//*weaevaluateˀderformanceharacteristicsfhebbottrchitect2000ssay (CMIA,emiluminescentagne0ar8lemmuno)ndomedtsccuyithC-MS/MS (referemethodanoray,gtMx (MEmicro.enzymga.
<+border="0"Plign="top"rd DRePsMMPair (ys)Z'nrSlopexI) ceptzyMeBias*y-xo(GGؚ8Q - 8oMEIAs.C-MS/MS

23ǁǁǁǁǁ0.918߁߁߁߁߁43 (0.35o 0.52) 2.69 (1.284.11)-4ȁ/tr)able>B-3bg_XNewmit®Ilus 6-AcetylmorphinessayN.orjana
,.utson,ŗHudlam,.iefring. hYealthcareiagnosticark,E, +/-a敟PNJփpCV’s (3 /d{0.`-861%CW(in-Lab/-ׁ991.62ԟ2.1-3.Вρ3.1y1.Mҷsi,#f91be ≤2=9alap`betwHjGeQln 5 S{ly,ߏf`samp@V2.550znoX e`AӟPgb9kA> 99= hadm(0.03%)c),TW-3-gluponȀ-6ǀzod`e.otiUs}@[noalxp ZwyRKum17 (7) 14`)yȰ?_de닾Pjln-boar;r+ast 30bêlxon')EmitB-320g`__Vdayva9cetylu͈rXAU5400lxyCh@yu>D.ilgoru>. SiasealthcYDIagnossnc.,ewark,E, 3 IbшcoPagreeί,.tBX4ddXoȗ zen׆י8bywo_Ydisxa!inHyighues;ʂȮWRCpㅡetłxlikerX̅ceÅhluP8˜clrequirڦՁx$AbetweX)b(exc. ]D:ccephge.nr ,脟su񆹾1sc@n?irhp遀 `hena FederG:1>HducHnxv@p,ovPsalgge2gg>AU5400riȐch8alyzerza0g(parkBeck𑈙0e0Incׄׄץׄ>BioaDiagno`csETECTABUSELiȞ,firm 2 (newAMHSAPe(es)dgewood,Y717.B-3bHg`__Or Ypr`icN.ain0.l-Beyrouty,̀.cCloskeD..ӃkX Jeff`UgHdPh(phiapA, OOOKBackghnd:umeX@tudhav@ocnپAutzދ}sIeipZ.,uth`ȴyap0prix׏.րǦhrapecs (C@fiDX2009;49:325-7))ongito,`sPi*th0"faqo (>1a،qIbeHour0dose)hort-cxcylt;5ays)⋯Yed."Ձrpomon-)jm0b?@pha@cyonlynˀircumstancesfignificantlympairedidneyunction.enalyzvomycinestrders (randoms.rough), intervals,(dreatinine-bas imatPglomerulariltr@oneGFR)verye@period@urX`tutoemPhethlabooryataighd teparturfrhreXmen`nequency䆹usenon-easXtMods:istO@sul(with0as|,Hoak)serbta`dall鉭1 (Dec 2009-NovH10).Ĉatching,㈸goriz}oungshusywopmVisuBasicbExcel.҈ :ԍ0x)athX10438nZamo3048(aagex = 3.4Ts(T (Pۋ|(T=63.7%,=0.2%R=36.1%adiaT14g/mL18kespevely.n2551n(8*)id螈ablh jq.Bȕu,til$Riw(ؘ@Ɂ:<30L/ (24.8R3790xRXmpri167.9heir70.0ކG@8߅߅gt;63߅26߄7Oߏ1߁<ׂefy0ng-/which(ρ(betweenucsHamplؐgуth 5ywi4224@1.rs/d042u.(6!44P5X׎681-Sn,KOs 2±0.46hi 2Ƀu@Hcross:443 10.5gAha.289πT;7i8(502?91??1.19:3??Concl8 B0jtyNJް:ssocid;sempair;ow,emX؏xsR2utsnpraHcEvc0Rximumnofrequyq8CwouldppтAinن hiw1/)J5-򒔢sugge)X(onitP臵py遺dyurrqgulines.

B-34gb__CEDIAycophenoliccidic!OrthoÄHliagnossITROSystemsu>J.ҾС(kami. @rmoisHcc,ƍont,A, eivenal,artYl@ranspla`P7(@yAort(effqanimizdX8:ӷZ5Qz™B-35g`__Biopray-basimmuno AzaleplzolpidemQpicebiologA.e2Hu>,.cnell,.itzgerald. R oxaboories,rum,niyKdoyrao@dsadllow0l(J,Clѝц(˄akaf9roxim hour ca`ʉ1shPalf-life`_cЩbeq–acil9ch@ȋyb VmeУI84-[3-(2-N,-d thylao-2-oxo)-6-ӂ[1,2-a]Pyl]jHd (80%)s0ext12-(4)nylarboxfrom7+*sivIolrd\c{hadҞmajx tWNX18esp`50%doXhoа v1׆wvelev8eupo(șA@alsouYBu sa@g “-” (robmugg,exu(ult)KҀhkypno8od#requirߴ݀.doputhre////Q॰Ȃxrq)ON͆ӓYpolyntraegen`"adeesepa ث?ӂs:hapjugVovٖroglobu (BTG)-ׁׁׁׁԉ 8ie9resH  uBquf؊_orpong̈́{competicheuhesɃ2lis-autox0yEvPIstiHor')specitH6N!,XpHQ%oss-,10Ȉ6z@tivityalˀue,xpressedsC50,P0.27ng/ml.orheolpidemiochiposayspecificity100%ȁand 71metaboliteithensitivvaluesf875:om1.056炧.ԅpicloneshowya, 112N-deshylB55N-ox8a׆Ն2ׁ.
B-36Ёg`__Isֆatx)sHabinhobloodnplat@m:arisanalytlaraersorϗ)echnique7773R.inkead,.arragh, C`ichard0,..cnell,.Лitzgerald. RPox̍raies,rumlin,ՍgdomP/i3u}Backgri.vncologyro!؊֍>sim8aneouscreenfro0ngߜamplcoГys(9mm 0)zreenxnot`l#vj(captu8lig膰`obilizsx)defi†diQest8,utAalso:v!le0pere(Machemilu sc?=eoyJthiފlЀnhaӉ2outp
duc/gconsumpϥha(:2avail CreliJmatrixȦdoߟߟߒ_stc,guory,hxic!с`c݂s.e or򡗡fiv-bh,had򰨈pncydхtetrahydrocann (THC)gB@mercialhELISAModf5׆wB1VIntser󊏊(HȎ'BlimiHx(LODin-8ciB҆ -A҃cc(g5manufacrs’strϘڮ,HC//_XPxalu8ws5.68g/m(1.41g64e2.52e7.3ġpvelnGA,xQas %CV,<12% ('J),+3(;20;16g_?:18.'GGGG9CB-38 g`__PerEI&DATrHFluidarbiAJ@RXeitaa8 ׃׃u>M.ff<(>1,.untz2؃MeixnerasɁρ. cDiagnocsϖI poliqN,____/small><ˀ/sup>Clinicaleferenceaboratory,nc.,enexa,S,
ANALYTICS <P>oduresultHcom`ed,5osڇxM-plEIA.bdrug-of-ab0dampspikwiison.iscrep8byC-MS/MS R:Yra-$ (21xes/run; 3uns):img0cix="00075"lign="ye"eight="121"pdth="400"(ߙ̔: 303k߆ڋXlosvaxd`10%(negׂҕfirmOv؁XbetweYenٌpriP@l;97.4%ɍ100%׈nclu!OOK$yield9HevelZזזA (Y97%)"N(1)ֳƈIn(tio՘(OPs8hae`sXductno ablishaHademarkY`. o`rnamd(Pty,ie)rowners.

B-39Hhg`__AnovaNo-Man-ExIG:Talimu،eiAsp9T..ei,.ʞ Mhubowy,.elano,.heng,ʁffYangi>HealthcADiagno۵ew0,E,BackgPnd:rapTloosag/Z+HPXoHephrotoxici@rans8hp蜀shqui`mo(s#s2apec8nitorI߄؋Ie(ibSful0aP/xasurǂ*whobloD (eȥ,L,S)/ology:nDTA5 µLPlyonboar ncubsibody-β-galвdAjuqrc@miumpdarcoӉǢapmxcuxylex႑)3excϯb~`by†?р-DŽwمÊďm0eEsep;uPnat,icaip-/-+ot)BferȜahrcuvet@w0enzytagdetлXa/ogcbesultsAHnewB-400g`__LC-DrminPCocaetab@AdulxLevamisU!C@bou-Diwan1B-42M..orgman1,..ȄQr,..olinelliȂ.Â(itchie3S.)Jortan. Univeryfouisville,g`KY,///ك//Studehildren'sesearchospital(emphis,Ngggi9ggEmoryՆtlanta,A,br`)MBackground:ԖavailablPkitme (MTX)Syva噻mi(EMIT)eag(llowsde0tiHnehrla@ooncraYs ow90.3mol/LpurHt㖠icalcispoint!rapeuticrugonitorandubse`leucorvschexis @bethlimigoHࡹc study؁erEqu(withccept"prՂ0.05$qD"ologPĈTestiN.Vds:paraer0odif!L iinc0sesamppvol7.0Lrom /(юibous`0,2)51AddoXl.02LLabyilonЁܖDᇿJa)fcub(sneg PssaTAKaboBiesstptroltargeLwABi8dyphochekDM-01#3,348.49όshnߋD-p;buffPorocedup[focxdxufact@rbsI -7Nfourmiaѕjlhbov@n=10)exvalu( per Hefficiava (CV)bQp߈, 9.4%;88`1.4`2.0`S90.9%.!er'$25)__,ߑm0CV845.7C7, 3`B`2.5F5H2.2@sd-GLrangH3-(6.ӻluTXYppAnstardHvs06thuh)r؂;2eycom1xrepor<Abbottx:IIC14%7Tڡ7unpIKvB{pziW8-ho'#.̩a9ŋrel{dataveal@hysaduposxHbi怸reeشd.Ȣ,ghbτȑm (2pnqM=12+,<>2B-43@>


W.teimer. KlinikumechtsersaTUünchen,unich,ermanyp/ir)Mƒhground:??8ivcystemsaseenporcauserc臰㊯iϋs (1).eal`examinsomeل ost)ipd WWQ(CVC)hurop(n`HUSA.7MethodsDŽted 4ypes, 2aderomolyurane:rrow-HowTM “Quad-Lumizet” (n=4)ZIy!Trilu3On(߇wco*withxsil on-baimicrobiXag:ygPMulExpertlԊlaP򃑈opiHLifeAphaislusŅP2mgaTalim(TAC,=7"50L (40µg/ml)22h850CyclosAsA;6100NaCl (2,5m? 6here0fҘo܈(ina.f9singa{increavoʃ0.9%),0e0mYk9ampglooFp1ozPma (FFP)iscardfirx6hform")racesh>ƊHgnif evОw shown7,=0.01ȖQ8631,ilcox!prankedi0a‡drugsˆOЉ, 152@ge:25-447Y6290_Z360-1040Á{ɍ8pevy2m(diaCMS (usu8ref)P4-1175-325σIȓ215anoڈ,Kl؅ї44 11-2o 8_[02-62U.urlaedu WonЅ(,extexvh uc`s 24Lti0pro1B-44g`__MaEthyllucuronHuՁzOmDHЍ0EffxUGT1A1*28p2B7*2Юhp8msu>M.ee,PhRWu,.ynch. Unhtalinia-S F(c`oPyCA,,ih(grou8l`,xtensP,BPpotaboXAheir΃1illuJ>1*28lymorphismsg XsignifntlPffНߠG,/p>B-46g`__PosiPropylyaЃxicity___\u>R.tone,.hu. Med"Un`rySouCainCharles,C, B-47(g`__SO rK8ȒxeplasmaYC/MSs!exona8 WWTY.ou<><ll>1 W`/u>. DrttLabtory͟inW(hȯہaS0uannry,0engduIxЄττΌτρDiviANeplogy ,ą؅''',!ObjKoؤhopsafesrImodmasPɀetry(GC-MS)TAoh eם(ludQM0amidophos,Acо,DiYPahyl,MaX,FenvxЇaDecarin)Ihum{ods 1mLH6.0h!uffaddQsampl /eskmixtu 18ces0rasonicsc!r 5nutTnrifugt 2500pmy`era0ns@rOsLB(3cc/60mg))dg-nelp:2mhloJhЄC0va40°CQdrynp,jresidu;disv;2PuL76¹{wepiq|Ra>B-48gc__CEDIAyclospaeppls.OrÅlĈsITROSystemsǃǃǃu>J..͍kami. rmoisHci`ific,ret,A, XőnBackground.a【iccapept`thotimmuuppsunۑXredugzinQncPissuejLfol(rgH0nsXnt邀0yomumafetef8narrowngcI@sstiP Lnachiez(׈Մh hsӑOOOH<8>™B-49ȇg`__D˚JValid.V`azoHSerumՙUltraЉߡquid8romatophy (UPLC)u>E..ugaa,Ӏ.akashima,.ascherhJ.aprnak,..eira. H lsraelitalˀbertinstein,ãoaulo,razil,
AspergillusspndHrmngilao8i .risk1toxicity$(drugiincxinX0sithec/renXfailure.Methods:Ƈtroluaficmaxop8dirPlysUltraerm:Liquidhromatography (UPLCnample@takymed.eHaqHewlett-PPardrmodelP1290nfin@drya ta7residuP2Htit؊100µs>esultȂylar)AobvP(r=899968Rrang1p.studybetweenA510.xµg/lu تPntuplFaxt)bmȉȮ(LQ),howestodoesn’tce20%+ga_b1sρ1OD)y-+OfJve,YхsiɑwOi-Pra-assayerveraa!ac102.8%b103.3%񐙄(ly͂yP׈Pv8CV7˪ 5%ܞ,rH82.7e YtwFluazZBufaxNosf`C(:aheʎBobustnessx8l xUPLC,{|anmeasuJotrolle0atarapeutic`rX`t09faŁolJn``si+Icoarouh=a'rp0lboH ,hospi! eimmu)ompipHs.
B-51Ppg`__EARKiagnicsɄIorhGab8n,amoghPacetam,ophm,:ZoniaPaBeckmAUeheHt8A9zer u>K..ohnson-Davis,.͂PuenkeׂPcGraw.ill؁ЁdŠ"An8(WhoffLJci. Unr3tah,altkȀ,T,уARUPntut CExpmPalog''*Edrug훀٫Jepilepmportantoˀptimizeoseorfficacy,ssessoxicityndrug-)nteractions`toonit(patientompliance.bjexve:heerxmfabapin,amotriginehevetiPetam,ophmat؃ZsamidemmunoaysbtadromRKiagnosticserevaluHdithp-channelutoAdhemistralyzer.ethodologyfЉstudi(homogeneousnzym7I)Kdesigbt`quaPAepilec2suerumlasma.\ dusingeckAU400num.recis8ccualeasureang|mariscLconducKplpatnownQcrl)trorial䓍sps.esult΄(hvilyd"(TDx)LC-MS/MSv:assjuflaims:clinneedsallyӄݐrTummznjtable.

1,ā.т؂,ӡ(n߁߁߁߁߅ɁParker. dLabo e؀,L,RogoɪhituNewoNYEBackground:shquiexcg"whoblo8rel>i0f)ubstQihfȭyѹGGmodHbatchy8cedɼlesukypmR̪buf§؄(emiHJifuge'` IjnsinkaԂp*ripx$0ugLockIdXaS(LSIS)Ղ9pfc؇ь:s)) feguarЄ\imWWPnn҂@ ipett,XexUˆp0th@mmizrech8ierrorR-BotpCP9-A2EP10-A3useusHnaly@a_ҽ񘏘ix*9d̎ee@i-xtP\total %CV4.8%t 5g/m3.410.64.321.dfunꂰs`itiv(20()Oņk  (up 95%I)`<100FreY@ograftpy1,..ƧЂ''''&,.͂umitafont>,..endes<1. ssay'J8X+0.30 89.71 µmol/8o 93.86[.yVS3.50, 5.06, 1.090.04,558%,h?718.6X7.18,`442.73, 6.44.88%דq9!l>G􌥵$'m3jx1569i8<>8ag08us,usrtifyefulnes ticolmo 0sakAZA.Ʌmpor1np29%hauantifiabˀleevelsf 6-TGNndrobablyorseransplantationutcome.

B-54gb__Modelingsimul|fositivenegȀhinterferenciwo-stagxmmunoassayE..ewin,..cCloskey,..tickle. JefsUnXryospitals,hilaxphiapA, B-55gb__IcePrescriptiOver-the-CouaedicLwithAUmmunoassaynheitros 5600ooolu>C.ammett-Stabler,.ender,.ottenPi>Un8rsityNorxCarolina -hapelill,oiNC,
TuesdPM,u260Q8Ȃh="0pt">Posteression:  2:00m - 4:3Q

Molecularathology/ProbesF1B-56go_^IdentificatfȆranscriptomicifferencesetweenlackndhitendividuals(thommunitycquiredneumoniaSev8psi煇u>O..eck-Palmer1,.ende2C.ongׁׁ3ׁׁF.†ay,..eissfeld.TseDAngus. Departm@s &ritlahMedicine,nisittsburghchoolo`A,)g߄߄߄߄߄߄߄߄߄߄߄ڍ߄߄߄Bi8ssgbr)M hground:s,XberXyhh1responseonfec!,sibleor250,0Ane@nly.onlyspaaj0publealHubuthecihcPsispropor褠8inʄMsomЦ0wZHanpNavereviousre)haCara8pisafadjuPngjsoci1[cdel!yactorraispobil]ɎerlyQdGQbii@m.wi,rpSylaypot0ra1b܎poostoodgoAcrojyebP.J8!howӀat@Oked loppirPYerapeu0v!ȫЈxaimyth)tudyasthyheYRte҄+crpps._Meds:ҋnvolsؒHᆀmultipPgenoductssaome-eRNAxP tmtifyjsRȅJ!ex(cYfromPblsHlP(n=46)bta؁Lself-iX23)žsubjsؘenlȘGInflammayrk(yS[(`IMSQ.ـxlargRspobspp@hȒ$(N=2,320Pi0mun-acquiApneumoniagx1870 alihRrelevimoecaAPшmɎȀ .Ӧɋ0pital7a(Ifiols.2Icase-klUh,ǁW,|.Áێ(;)`chS)(Zpeا 2lud80moghch r.l8had.ach𑠉i;jay twipIlluminaum0RefSeq8ŝWBeadChips®,ta09xie824,5well-(otN*rrawatakRMABRBpn(y,bp,iasxsmzƒx@(ORrSignc䘱MihʑX'pr"ck)HiptsAf!sc1FDR<0.05), 21߅߰"det0aetweenmn1n up-regu81P14ownDͫrbadH/rihHaPathwuM6񻔅%p䈯lacks ΀andhites (identifiedsingathwayataMSigDB]romeneetnrichmnalysis).hesesreostlyssociat(with-protein,incransport,[criptioegulai,nflammt1apoptoigx.egardlessface, 11sediff@alexprpbetweenPdividualsevsepiفout72(FDR <0.20;unpair SAM).
B-57g`__PreeChateris;(IgrЎAP8PЍ ram-ntiveО0os7773G.yamfi-Brobbey, . UnrsWr,ondKdom,geYquAllCRodurXcagarose (F0S8cKtdughbor9peiزjUKXepho*؏0olQvisu)und0(ratta ahlluatorPД:g2ٯserseg*(CS)3hpur؂EU5x-CS< GABp$K(et(ɈpgiNꗉ؂ذqjym#(NCBI)atabslo3earto(BLAST)ESULTx1exceptl 2րbla<>OXA-24-likeKlebsiel@pneum؀ bo3wwtّnamely:ɼfinoglycp6qN-acФnspy(aacA4),lo)(_]catB8XandminogӀlycoside 3’-adenyltransferase (aadA1). InteggeneCRorhetificationflass 1遪onsastivealliexceptepresng 94%s.
OXA-23-likeB-588Xg`__AovelonoclonhAodyJNon-Je(LuCaȐXItsiologBCharer'''#F.ang@>1p>, S.anDepart LaboratoryediciFirpAffPdospitNanjUn0r8y;NKeynqChp,'''''oncqyNBack:c˴AleacaȃdeathorldHe.bHdmmunorap!targeXtumفxPr㮱surfa`markhachievxsomxucceɄEPthods:ALB/ci򄢌xdh쇡adearomsPC-A1spleenH7v@fmyelSP2/0.po`whichoducMcAbgt 0obtbyeaindirectELISAcrbeciftyuBcZthgh<ቘ+fluorescesayrelmolecular(Mr)4`cogS`ohȐ؀wesnlotrhPoche(aysper0mYottissu77ʰ[pp8onsofgtrixrevariousqt,R)n20 ci@y>inhib"ie (al xxgra(ablishupPinj@pWPadmin؇0iffPdosesmةpc!@alremoweigقweekf !9Lw_򈧎wwtr(Aout24*48荊rphhIobserpoptsف5lowyttr'>es W,ˡ#seeQNSCLCۓna!NJ488-bPngoRIgG1bcl ti)purifiedӀcAbas 1: 2×106p
= 0.032B =15,y)ă߉-߃߃.)48)bhxtsi@nG@lobvious- phgyhang@/tnapopt(Stim I00).was+byunlabell-RMechnologOwiscshoul8eerifi.

B-60gb__miRNA!filnulmonararcoidosu>M.etrek1,Ԍ0omankova2V.ol߃߁߁Eriegρp>. PalackynhrsityFacul`Hospitallomouc,Nzepubli///////-1br؀)MACKGROUND:S)`n-codhs (s)qnvolv8ptranscripregulnume@suHs,ainlyiagradtarge'videatp,Pdownx(sssla9ra؄0dase1o؟꣞inmabo0ڝle(wwq.METHODS׃pXper8eeR380(TaqMan®rrHMicroAards2.0bronchoaolarH0BAL)btHromxyientsPth/(S;he`X-stageI,MHt:aft02earsllow-up,smok`ЃcXubj`C;x lLU itdur)鋟ph(enigRayrp቗e(n=4hq/-n=12)quaіRT-PCR.aricomHrxalgorm@applato0edictrponRHm waysmط`turb;g>ESULTgreveasHrdiffЇy betwу߅O`xplet-7cr1@-381"dQa-146aQ50L86K212L2N3K424;`885-5pRgXhIPboexclud fluBX:nt,Pgnp1inthstudy+IV ongoRfirmWatX_'FmwGvH'֩Yダi!rerimPvalم9iologicsy(mWONCLUSIONo:det!ݩd=7lavIo璯.Ӑ iןَ6ʎxalyngrx0pport:GAZRT/11117-011049-5,S/10267-PPUF_2010_008.

B-61(g`__ErythropoietPoiGeneolyp(msxdepe(ntAssociWAnemiaPType0DiaXM0itusu>W..o<8>hp/b/u>,́.n2>. ؃iX׃i>DehtMiR`h,Y@'s2QHospl,aohsiuXCity,aiwa _____GALaboratom8,hamgǃMexp-%C`erWWTY_BackInd:VIbu!yucognRdiwtdm (DM)withӀhronicidneyisease (CKD),nemiaccursarlierdsoreeve8inhowithMomparedohon-diabet .aggravatesxe䂸lopmentzprogressionfo`microvascular (nep`pathy,nmneu)jmaρisch ct,bOperipheral)licatXsa{es,eadingincrdospitaliz orty.Ԉh`ologyqņxyeultifactoriЍ*ncludXnutriPdeficiencXinflammZ,rugsRhormjchanges.ow,herenpisposffect0(Ht’sisk[ɆhasHtenellxplpd.equXeЇ8`erytoigiotenscon@gnzymetu(АPs`-alph`rep(edlyssoc`h"eΔpI9xhimvestig8 5otypǀχχχχχχχφts20.
JsmsotSsifPgIConI?9-SNPDM ggsatHpytpyVrr@@ur0r8vg.!Yurbou8 0@ggvsRwihelp釡ifyRvelo0nnov؅apAoʭ#c\.

B-62 g`__ES EBV-encodsNA1-likcep 3olv1inflammvrheupoi`priH߄߄߄u>HM.hen1,Á.uPJ3>. hiXׅi>DetL MHcinHChu(M8xlospital-KaohsiえC`City,aiwaЅoooooWQhology,iviɄR<rgؖImmunĆI!Medicine, ӀChangungemorialospital-KaohsidicCenter,ˀCity,aiwan,
asituB-63ȁg`__EvaluSNPzro-bipneрBriskchizX8iaY.ڼ ,ʖ8,.i,.ӕڀȁL8YBP,̂. DetLpo ,יhinaospitalichuanniv9ty,gdjh_Backgr:ӈ/iw혀eriou disab(gQe,aseenӀssociatedithizeableroportionfeneticisk,utindingsaveeennconsistent.icroRNAs (miA)remallegulatoryҁthatodepexpressapximlyne-thirdڂxhuman*s.Ӄchangesn severalsychrandeurologicdisordersSwherolymorphism„Hvolv(c!ngшoaturity fluenc@usceptibilɁ(szophrenia sot;elucid9.TI tudvestig2هYbetw9…Yle-nucleotid70(SNPȋ.t
DROSHA,GCR88ICER1,GO0GEMIN4aase-tl256hi0?8p(sZ252eqyych(age,,Bnic )[ Aᆺ(rs10719,s3757C42330Y636832Q78134741)Xhotypbyighsolumelt(HRM)wesultsfou@twoYrɄ+signifntțlt(x.ԃ8reZ el1[@{ (TTTC+CC)hAلcred;`ddsiOR]Q1.58 (95%f inv[CI], 19-2.11);…?9(AAAG+GGOR+49*CIq04q3).Ϥ⍢haplɗ!:c)X0showȍבᩓia.מlsoXmpxlow-refh)groupnnfavore8 шoi,median)s#/ndif慟;_Wa031-fol8-x9W(OIWConclu:B更0vHirst倉aspecvar@(-redB-6bPg`__StazۈCellularҮh`Bloodampl0foron-InvaBDiagnosi;Prosu>R.erno
,.rton,.una,ʬt,.yan.1StXknc.,aistXNE,z>Backind:0ng)molecu(m*bc`Ȫ@indHtorsavirmeistqwqIexI boex.fpR͍10haѽdem0ȕmicroarrayquitrever(xnscril-timeCR (RT-qH):XbeapPQSuchmohhaXbe񛲀impjbo`disharerbiomarkh8coy,utȞ~data`8H(QAoAiissuY0ondsēexiv@pri腱i.͋Qхjstro"up-d@gєȂ@8tAs 2ou0post-phlepomyEfL耥shippnivik0xiR —kn:oTipy-PuchhwThempizЏlop94oicoapIT*im:teafВdrawObjveo0ndard؅0GERvy)andiAmbiteureM:Z9nPomxalthonq@o+K3


JÀπ 2002;0: 1932-1942 2.audtM.lj8g`roflymphoidalxancȃAnnuved 53: 303-318 3.alEC,htliwaM,arypGaffneyMlńטImany hueripЁahhighlyensit  exivo ub+Јsmmun447-353.

B-65 g`__quyrs12979860rs8099917l28Bporp(ma@ntrolroupex 9阁;araz`Hospitau>Sitnik,.yakawa,.Ѐ𖲲QDMarzoni .ƗolJzMbN`odriguYxC8 xASanxParmezan,փr(JnirPPPinho%tinsteixSãou, ^Back9nd:yvari#iILqegJ`hrop0x(HPnt(@qdi8`pon@QnfӼotypCV$findhbeeonfi(˜q(epe(PcohortT𸐍gassocqnucleot–m (SNP)t,0,alsoshowqgn9ƂaeousG@ar0(OrNPoximity  όrǃgscribed,uchזpffB lel)؀worldDillXfew(tabouhdi`ibu ouruyg0!sƺ҄studtwo`t in8est/'S,kYuIaqupmA؀hb(ApplQBiosyms)ABI7500uria؂Ŋ"minkitnaly𳸕PHchrPiciayˁtxUmv(who [iplasmaampגᄀzȕ56 a8iv0H'Rs: 1) 37nG@healthyonors; 2)yݗϗϗς -|accessstPiȉ*s@aO+chi-squٓ3Ys’cor(8S 5.0oftw)wesultboq,X,TTKy.4%Ռ5Z21.1sGGpnheoӀntrolroup,utn 10.5%ItheCVXfectedatients.ԁdistriionfffer0llelesQbothsastPstic yignifh(p =0.0058ors12979860n1628099917).

1,..לy2A.̞ield.urAnւ.Вt. QuiagnoȐnyA,Genei,ashington,CЁ٬]Backnd:yto)me450 2(|)qinvolv՛9metabolismeliH^many8mpc(drugpolyph@2%a9actrapeca tB-67hg'_[RHd`iinleuk`(IL) 28Beirbiologlmh'''$u>T!iϺ/uE.Ø @.otaׁׁׁׁ҃rp.uongo燉V߁߁߁߁. CPahy-ToxicZ,ϏdaCЀ8SXgino-EoaHtalwww wwDepartt1GasherdUnrsA*Reggiomih}MBackgro8IȈ вº7lcoretweenJpfolymorpӀhisms (SNPs)nheL28Benendratesfpontaneousreatment-inducedCVlearance.owever,:diagnostictilityotypesotetompletelynderstoodrequirlarge-scalepidemiologiJclinjstudies.orXataaringnaturtorinfecti(8subjpsithffer(_Z,i @ensitivmethods`itabfprocessynonvasarchivbsa `rePnt`needed.
B-68g`__C׃C.mh??<10u>,.el,ʃ؎!nen2HigginsoRaydG.uf3YenaudFuǁNjgǁƗ4ii/ׁi>Auto!(snc.,֍a,A,ςςωςρUn) BrshbiVancou,CXd euebecRM(le stitutxmacoCr0,фx_etvahCkenzymxolvdru eolismxthway"wAWtransrXt9irecephoul(dXAdesiga߇۫y0tHfyinhxb*NFecacXrxicВϒȩ aߩGFoffJeasqE%whichnemostunzHyxlymorphgaBcor.paneanSmodifiddA placilyt@orents!evP ea0sprotocol.1results,SfurbdevelopIo@cludn`linx>񗖅.450 I郢xsaPonwoiplex-PCRx@aioFilmChipWR followq:*2, *3 4 5(d1)p6 7 8 9 10)1i1241,*XN(du.)]nAst,/>®YP2D6Tspngleultiplex-PCReactionanelorenotyppostfheboveariantsxceptfollow:*10, *12)7,nd *XN (duplicaY)].GPGX01c2Xpresecustom-builtpsevelopedromcoresI,spe(y.ԁdesignahdeinharmacoamicstudyyddуprimers/probesn ialGT2B72]etic .imilarly,tamoxifen-relatOOONtwoWl,3A53]zSULT1A1jllssabeenptzLtestiDNAam tr]bloodse@saliv؁utoGINFINITIStlbansB-70؁g`__GXymssڅhmokPsCL19P21aCzenwiayrPlfarcbu>M.etrekhǡ>1`/uJkova,.tahel2F.razTYskyρ. Palackynr𔘏Facyosplluc,NRepubli///Ȅ//ooohjuNB@g:igنya0v{lamXoryellȼntho9tmanonaȾe8eу9n (MI).ÚQtIcytex9xeroscl09plas (e.gHCL5,kohأo )Xntafu(PƧicumulmacrophax_XUthusBributozsusceptEMIim(fr.ereHXinvig1associbetwescٴoiiCG!gg[.eds:dilot-)studyلĂp,sPCR-SSP,h Kthre ؄ka ((BankDs2233872)jk2@i11574914~5);қAp(mprd 211150`althloubjpsR:ԐYaso8rRller q(SNPs^Fi `p>0.05Howeӹhzyg@HP*GeZg7G)2lrmo9H(1%)Ɍsr:gb (5%`Px GGotyp9a0d`yigicaI(p=3)fQPptipspluJp(yӂ09onclon)oughaXܒoptP߉ߕ g`,8Q@OuYPataa@bdepe(rep…TseQÍKabo)@es/Os.ur鯉alys0ȮTO"desieryP:GAPFӀ_2010_008,SM 6198959205.

B-71gb__Shortandemepeatnalysisetectionndicatingcuteymphoblasticeukemia (ALL)@currenceriorolinldytogeneevidZu>A.̅0hersich,.an,Àockwood. Washnivtychoolfeine,aintuisO,N 1b>B-72hgo_[Ass0N kbacavirye:iQHLA-B*5701ۀC/HCP5>s2029M0chMizoi'''"u>F.ANCHEZ-GIRON,.ILLEGAS-TORRES,.ARAMO-AFUERTE,ɂ ILVA-ZOLEZZI,ʴERNANDLOPEZ,ǂIMEN,.ARNEVALE. 8INSTITUTOACIONALEEDICINAENOMICA,XICO@o,8Bgnd:rosp`scr ȌQ olish1ggbpАH(AHRsCau8k1(G)H^hkagxqubrium (LD)ԅ(rȀ/a=1hO aimsȀPfbncziLhrex8dknowled varr y/.pharmacR.oMethodWJot(d 300omBGɹryqjh (MGDP )ermPaĖmS/%cPTaqM(SNPJay"fiby ȃ.14Q"Ǖeg)w`tvw`rbaseӀorDnalysis.
arrierrequencyas 2%8dhellelic 0.010.aplotyp8evealeatŀCP5 rs2395029(G)renomplete(r2B-73g`__EvaluCepdljXpertTB/RIFsay0PdcM.uberculo99rifHretanclcalpecimensooolu>J..ee??<(?>,..im,Áooρϗρȃρσρ˅wE.a߁߁߁߁߃JOρρρρShinׁׁԔׁבSeong߁߃߁߇Jρρρυt.ark. Bׁ׀Mole arġ@nbLaboratory,epartxߡpdicineeoulΝ8Universityospital$,ˢa,pub1of,A߄InterDŽDŽDŽDŽDŽDŽDŽDŽDŽDŽDŽDŽlj߄߄߄Bhmae!}Background:ccuONycoiumA(PxssspiHqdnpulm8is胐also'''ti-炰drug-=traPimporYadt^.Աuto hkif nds-fذutum-cisy8maal-tePCR.txcmWPDNA,4sh0,simulxsldAfiewitwoour8We庻t maFuseful8I.Methods:q̃pn 71h (p))hicherthyB/NTM؎c(LGifecX@,s)@cid-fastacilliy olid/liqu@ia㌐uXf8elydarddR{`߉߉݃comhhenotyptsMA*g&ay81-bpg-rmhregq(RRDR@rpo1Beʜ`nitroimi5aknownumXell Qhk+cs稘sPCOZfrom 53y188was3p39mear-^32nego;??9~ llɟЍut"n 21/ l(29.6%(,ߓȇcord9susceptibilٓe100% (61/61)s__\U98.357/58HOhowmix0wilp0ѱ֌HLŔ_/ 1.3؅`4ēV.Ė7rio9֎s/5Ë@lus1:8Ӗeduc(tsifampӀinesistancenlinicalpecimens.tillenasy,afe,ast,d0liableoutinen-demmethodorimul`eousetectionfTBCifamp.

B-75gb__Evaluaa iCYP2C19CenotypelheenMarkSorC..eeττ10u>,..cM@in//,2//Rs߁߁߁߁.abic߁߅߁߁...eo. 5iPׁ׀University)Chgo,NL,yUtahARUPaboratories,altkeÁp,T>BackgXnd:ǃpn᠈uantieletrapyt spirin, opidoghibitsRfun,mprovingndisecutronaryyndromes (ACS)́qhergoperDinter`)PCI).iffere@sdrugff8cyreinke odžpharmacokHtЫlly坼7)certaXp hopu脩0CSshocarrsӄoss-of-]ll,.g.r*2r *35,aveerskBdbdiovascr剁eaf8CIFDAssu aox@warn9r2010`tat 2-14%Upo0 lrh؋esЁavailpir鲡iXllowqhehHrofessalsixn`medThuio0B;acЃzay`8idLucЈgihbjve:׶®wo9 hod0esignctria?x0H0ssP\rexduclL+aj:ɿX˼n udx111amp񆢃i< (*1i**13*17least[hdologincludDex@iExdyutom0_0/ILuaxa`wPh 48[bi-dirّPqu.DNAtracZPlo҂R7 (n=241))l`s 43obكիف`ohJr`%u`Ҵ-QIAPM˝x(Qi,ildAGanyHMaxih16ˆbPurr‚:Pga,d,is"nygNAeRoche,8daptW`in-daQetwee) HQo/)known0/**2/C2|̀X4Result@CȨe (100%)daxɥ t8NDžea0rߴ᩟(H]ymౘ-76hp>F..Àhan,ʀChow. DiagCBioscceɒPrp.td.,o(K)S.A.RChina, GB<ȉ[guishPV́!xowhic0usefuprolpurp1vac0ҁ2ramurimore,Z?htmvyybridizI@pu؆48љ긢a0run)SsaPpowЂrPuثimeeds:"K18mph9sc119XPI΍a ll@liqublog0edium (TPrep#si@_]gи؎Ğ¥$Novemb`2010qJanuary1.DNAwexbyiAloodinikit (Q`enP elu75ml1qbuy Naio-label 鈻bV@esAwmixPCRt9TaqolyP1فقx-hurcyclh8Rl2H4/p/*cHȂfurer’struesultAȐOOeirs_zsT, 80(x؊39 negv٧wtݐibk1ocross-S`RVkqA`b90%)OOJBPParā~_[ityU87%:91%ir-XBdreducfrom 10735v7vqonh71malZ7R)Ë@lon:WWW)_huapillomavirusi1)AHѴA@thhelp`moP!YG8develo邨,冊q,jcXtri+nc pߝؕQrlob.

B-770Pg`__E׃COLD- H 8oMelqK-u("0pt"><Ӏu>M.aekawa,.aniguchi,.shi. Hamamatsuniversitychoolfedicine,ȁM apan,
lj,r1:10,022521XY0&'`ӈwwwww㑏mpyɂ??giwhi_YtjParvisiiO7M vƈX.ϖZۋJshbsimi9pȩ DžSha1ttXy\؅-Ȃ7beerIӊ;autoУhz thusfgaoul# tcreXHǻWhsofAusp !oduc`i]honclHonv猏p9ƕ QXR''

B-78؁g`__LȌjFactorSYBRDžAR-Uǂǂǂu>B.Ўard1,ʸ.̷erts//,2//G.altezo3Sc`erمTgali. Dartmouth-HitchcockdCXiLebanon@H,gggggNoolCؚpnianstit0Ny,asadena,ó@ZBackgroundyin8a neـl-tassayswtquickheap`schop-worHpoint-of-ca`locReclJdYvariousbe-basmistrpx0ra19mXv0yficaltiplex"apabil,xЁdy,oH(monool®??>$Ii jun9melt-curvmrema`moc-!  I roraǰsouHoeyg-ҨmmiRavable`Aix (Qu`aψψψψГXeC߁߁߁߁߁؄oj@////foӀnt>
@up>)singast-rampyreal-timeCRnstrument (theepheid< B-79Ppg`__TREATMENTUTCOMENH-NEGATIVECR-ABL-POSICHRONICYELOIDEUKEMIAML)ЁxSu>G..saur1,Ͼ@lekhanova''''&,Popov߁߁߁߁.akovleׁTi߁߁߁߁߅IvGryazMisyurin2Much,.akiX3I.rylׁ4Ssiy5hum>6i(7sSolodovni8E{wLavelieFechinǁ/font><Ӏ/small>
. <912??:NResearchn`oremat1y,oscowi>3Republiclin,faoooooi>4oojSverdlovsk`̌vh//߃߃߃߃5߃߃چ%SanryՀ@Permi>6K0X__ˀ⃇i>7BUnclNovartisharmHσσσσ8σσUrtAcadem@brh)Mackground.pproxi`ely 1%qtheML8sootave(9;22)(q34;q11)etectableyonvcytogeneticPbutarЇBCR-ABLusevealed9fluorescencenxtuybridiz (FISH)nd/xrse-transcriptaseCR (RT-@).ɇ0hbff`cythXqpهrinsnclHim.ossessetreatmPh-negw-ypohts.thodHIidiagno(cp0udinghromosomp؀aXys0(CBA҇an531r׃сRpermaf124oursulture.-aHypsin-Giemsa톂.˃otypeserexb1ccorrtoSCN (2005HAteast 20Aaphhsea8sampxzePI^whodGW,ƒXay gual-CurcF# ԁloc[Probe (AbbotpUS8appliPa0xui (I-~(avail[/tiؖP@y 60hs1asXi"/ljř0l-qua!*13--.oXuyopyrkindo}#dir`equ9\0duczomp`p(CCgRssus؟th-N%Nestoni,lood,h9)Ũ-freeurviv(EFS;dI)0R-to Jdef`fbnnu`nyfollowٌh"ccurred:2signZf8 (wpYEuropeLeukemiaNeria (M.AayJCOk),Yg8`AP/BCrathQson. sN0k}12ew(ԀGP(2.3%HowI,:mrb`9k60Tx2큸10沰ywiPཉag51HP4e13a2tan@8O-84a2h9`Jidifx. 9σcИ0serӧI)HoĀg 2ج2ςo>o on9foun`ZloHSS , 5’Z3'tder(227uxfe86q7oipHlQat`gi`_L:3Mnumb87ϣ́p̉22% (1-50%!8%400-92OnЋg.ysT.Ssubtly1qfwF.FSeoѦ (cX‚h244Xs,9hlong-m,-@datac}: 0.14±03sp62q03 (p=@07pwhio8)zфbos83585Ҏi88Coٖ10OusuggЋhPmecismORӀ-ABLormationnh-negxveMLrerypticserIsf intoBCR,riceersa.nureriesreatmenttcomthisroupesignificantlyorse9parispwithposip؂s.esistan8ebved-!indepe(8mechanisms,ecauXlackAut:0dupl؊`amxa.

B-80gb__MethodÈώGMTypermylcAnaly߂߂߂u>J.effs1Dartmhedlchool,banon,H,-HitchcohMCer /Ą'''&)brЀ)Mtroduc:oleculariagnoslaboratoʟafacingicHsqdemandm6oncologyeXngHtte)volvdetejspeccquirDNAxtractfromClin-fixed,Xraffembedd8(FFPE)issuelsproripurex addH8wYإ`f)tumɟpmo nuʇgen᧺Jimpor0gy,&jƒZ-guHne|Xansa().lioblastoma~k܋ir9zfourespoXqvb hp҂(jrugmozXmide)eu@tyi ʄyudlesde@dsP@*$)HPharshisulfit.ЏqcedtЅ8VwoodazсABevalujed.ﯻs:rtegaBsp Ѓearchdƈo.;/.wasJrmdy`PCRpachYwhiHprimersazun'"ڐseqbGel夸pphb衡xas8s.욑,*PyroMark24hsequenp (QIAGEN)J`L 8gP~(DŽƏRetOctŏ=錿㈙nt8/O8 (69%hilemar?318ghς.נ2am'*䁙'P'#ssaXvYArd> xVH7yR)z܂Xy)Pm⤌po/xty.Ƙs2eρߏ:<ang%14%53%7Êlus:lxike϶ʆAmoular,e٥Ӛ@lack"ensperZY벨gmajȲpubh@5dnspꑸresetw1mhRhimiyohraax`hni,owhr,otuitȊKanc`ris%taC falNaқost-YmanipjЬhr)tocolPl;su/пZrobus¥`but9faȑ{VPWWHHr^ɉ}Orror.

Z.in1Zhe0u>. Beijinghuiyliuospital,€,inaXOONOOZhongnanfuhUniversity,oqbr)Mackground:ÂencataractsheainuseavisuHimpairmehildhood.ccorditodifferIformsndteslen@pacnderlitamp,τcpbvided88egoriwhichcludeRnuclearf,onulbluoRsuturt(tictct.ԃ8obj`PstudyovestigHutationatterncommonlyorbiouseneasporadicHeci(ph].?Methods: 5iithhdryggw(ecru B-84pg/_XRapidӞf@Det镍i#ڰ>Mycobqriumuberculosis* (MTB)jN/s͂a (NTM)R-TimeCRR(rBl HybridizAssayooolu>S.hkY,.˻8,.wRJim,.Б`xi>YDagnocYȟKo,publofGGGDzyhhnidЀboЄ<<W>G@ь7777;dit٨JaaGGDXttHole0ȭ`a0bHlY,roduc(oԇTM&ƒRec0ly,:l-t|^gܥhgeXflustha@ttAtl)DyOLmanageQsmtityJhIxdXnhb@fiabilmltiplexWى3/͏rs:1t(,rNaccur{MtlXlh@g4ce 9 (RD9),S6110 Sپß-un (XrpoBYsPhenGf bhϊ9reo(,yidaernchrol (I.C.anyckQelÓs󍑳Ѐ8heckedss:ϐ161sÔ, 103nw؍;58ǀ8#sv䐢ǔ__was088.3 %6ˁMhowe,qAlAlso,ta`͛3p_4Cooocorondv!oY#gce wqf uccessfulɇ˵A.)racelleɓ'onclusӀion:heseesultsndicatehat(essaysing0al-timeCRisomparableithmercialibasednRNAequences,otykof 16S#(e.g.ccuProbe,en-Znc.,iPA;`nogenetics..). ethodndverblotybridizattiagnisattmentallowor@rapiddXifayMTBNTM.

(B-85Agb__D@lopPamplicon-targetH ۈql-siz9sTnextechnology:pxiebiRCA1/12 ///>E..a1

,..hoYim瓱8Parkׁ׃ׁȁׁׁׁׁ׃Meong߁߁߁߁. )׎i>MolecuhĜoLaboory,e@ehinulΖzUniityospital$,oP,epub8,bXsearchxstituH@BiosciIx熠aejP,zbr )MBackgrounds:Ξ(NGS)Gyatohangeurrpracenocs.ԣ/g9"su(p"I/l2MD呂ariouhlinlp9sQ.erxwe䨣yPШD!Roc0JuniplatmevaluxperagainvSrg4ͪmcodkgwfisaHprotoco`لnftadapAligHindexreiffpƒiknowna0rutrH]ڌtpoځpicP edsystemoulthFou w@clu"Rser:/dele@nucleotb !,fienwwOcessfullyda0twoxunHowhr,nlike''ggfalsed(cJnomopolymY0y9criiaaensuPhnivddxpdaacrossPshHdtzabil!m8`hr8timesgÑlP:ϏxP醘satout<(/tצƄ caluoissuyrrrHremybolved.B-86@`g`__MycopheaciddehelZ1un-Hmanismagaoinsxty?oookM.asim,.ϛXch,.ahu>Asif
.hdZCGoeteȀg`eqyϺϺϓ:wGφφɵ⎐mQectB(MPAmorgxnshnt i8aptt stoop .հz@eomPro`*ob%myoy `2pLC2)pPip( .́߁݁)hos ry\ꒇ졹deQlarrif̛x7hdesbimportЋdiseas@zaithhstudy:vexhbisrupoloteghyp͍'>me<hds/uvctexposedӀoherapeuticosefPAndxpressionLCmyosinightha`kina(K)asHalysed`gCRimmunoblott.ermeabilityssbyeasurtransepihlialesistancTER)luxaparacellular/arkers (FITC-dexcross'monolay`.

a>B-88gc__FD(riQS3N7PWProXp-(GuTiHiH@Na8 u>Y.e1,.eng,.iǁǁ2ǁǁQ.iuρσρσǁǁǁǁ,٪ǁDžOǁ.i߁߃߁ŒXׁׁׁׁ. 1Westhinaospital,hengdu,, a>B-89`gc__A軁muAPC`afamiliaHomatoupgЃǃǃǃGh,.uaF.hengi>Zh n8HosplWu)UniXsx,,:aH^Backind:ƆOOO)utoslomБsord0characا*PpscoloXcarX spo`@9͠^si (,D`24)KXXobjvour@oycaushPdefPssoci¡R׃׃׃גߒycsscertacphrwqQre@s99noscopico8P0lxn.loymPDNAextJ&s enpdid[!cconduerђ0PCR)Ks9@s3Acc@6xwtnu9(range 100-1,)%͇ç2di! /vealbinsv(codH610 ex`15yU(c.1828_(9G)@hich܂Ёframeshif(p.AspGlyfsX23 @ 4,utabsuna:pX 200rtrol*proYrunc teiHhon633ءciHdostigzv du,H_Zeozyg_segFAPIeHrefcouldgarȽIbhoŽt킑.׳M__n?,hichӀannrichheermlineutationpectrumfPCne.

B-91gb__MultiplexluorescentnalysisfiveTRorJindirMD/BMDiagnoxJ.ang, B.ing,.hou. Westhinaospital,hengdu,˂/isbr@)ackground :[MIM 310200]aH376]rellelic,-kedecessdisorders@usby։‰Y@ۂ07]ocatatp21.2.^|ff 1P 3500 ()d0,0)aleirths:rapidlyrog ,xthyoyseIwheelchair-b Xage 12eaр!diearЄ0iirecadeliferomratoryr0r@cailure0hiЈilaYeasPartiallekupPex:cctB70%1czY985„,QvelyrremainIsȁHpoiPsPlarrem@Now,tjb1ыdetCalmohp􆛈'''' e(g2-dependXamf$ (MLPA)(op|n.ut,tG9notZ0.ere`porome-brewnkmethod~̚ʒri@ph@܀0alternop"LJito҆(ͅ:s:our0troniccros@llites(₱beginBpPoarkdownst( w󐈋,KrimdesignedmPCR).Res@W@61nrel[PlescfthHFaeaiasaponzLeiscudyoph atab (www.dmd.nl),apu8Jh`rozygtp+ma`0.99onclus:hssavx!*/rfai઀i`.Howrȁ(rb ap@ximxne-;m i(88ghP֢sluf0тawɉ\risk0`ua(a.zy.ϼϼ B-93H߄߁_[R UDP-glucuosyltsfer1A1 (UGT@)ǝ!MscreeBH(-polPMeĀa8 DŽDŽu>Xie,ʻ@p,.i,.in,؀xu0i>DeqiLaboMedhnW!ChHotal,ӪuUn8rHhengdu,k, כObjԫAScodIr`Ȃ݊(HRM)>BhfirMǪ[xaÚler-NajjSynd؅ype2Dneouhithggf 2ar؅ lrud(tudkairoN@1pp`bloleukocy`,~3ki0yomo(njȢXmUhduciciwHAixtutwhesɅ{ssequencÉPagouoOO(vw@agnJdifHtw tʇ.exon@Fig.1A)iXnב*;Ӈerؕ@a莐 c211G>B)!R ’s ׺noi0WGBɴվ𷩈`G1DžnucleotІ (Gly71Arg))Ecaus8WWV7 align="basӀeline"eight="629"idth="400">a>B-94Bilanesi. Hospitalfesenzanoalò,ɀy/ibr@)߅߅Background:olymorphismsnpecifice8aveeeneportedst riskactorsorhromboxldisordeandeyppea@odiffer0revce1`*rpopulationpaimatorksuate,ourograXc(areaɌrn̓IfrequiȈassociPoOHatelec,laborayéX݈posiҁcardiovascrccids.ethods:omune 2009Janua2011, 653thgean0@16-81hs (me40.3)cred.Ɔxeachllollowingva҂anPsehFRI20210A,Veq1691V5279G (Y1702C), 5,10-mHypetetrahydro88duct` (MTHFR)677TȀq1298C,y퇨TaqMl-timeCRcommerlit “BioD0nneoagzHe”,iodivit Zfargets,corPpondawm,׊ѕpa`lelasetubes.namplmixtuXboyaggrot"mqQ2P?esult844/Q(6.7%)ubjhomozygot\߂.Ȏrs f)34(0emtZse0monlyy4|Hp)@D1neȄ;6y22.6%5-40(2' 38x///37s<놇3.2& WhbservehҞڞk:Ĉ5h124d(19.0%(DT18 8.1!Ԃo51 (7.8784(2.9!doub'159]24.3%xS o█'=bh45P, 29250.sx9ed,(փ/betwG E˂шG90P.$?9 &QǖF2 a6mAgaՂA79B-95xg`__ire shipChREBP3ϕʇcora8dis@BH(???;S.uF.heng,.iu,.ang. Zhongn HospitpWuUnrs,hina/i3E}Backgr3reglipo9IglucutilizaӀtionnheiver.eportsuggestedontradict ssociabetweens3812316sisenXndriglycerid(evel.eyposizChREBPpolymorp(ms@withAD.
a P
034).o߂diff8>cxÌfouotype؈Kdiqbuof7798357,X17145750x051921Gd.plCCGChighw(u<OR=241.608~3.474),sGC,HT(CpуЎwws5Awydotianytcpɂ7SNPcڗIԁΕ×lus:rIucbdbZappe((oressusceptibilityWWSTuesdayM,u260 Ȃb>Porhs   2:pm - 4:3QXa8 MpproXrypplHf/7>B-9Tg_XCharxzKe}mrialMIJ 6201-aЮprote(CRHsolCecombin9815ץߥN-labRPp isotopic-dimsicu2ψψψu>E..ilp(k,׀aox..am,..unk,..urk8K.Жney.QN"IpituPStxarLTechnology,aPersburg,DxxFBacknd:Tudou`demhfittwop(4fudopbh'''$(IDMS)roachAqߓ.ɂXׁrequir8bothq.ayq,؁sufpuraknowcrb,)welfQtQerJwtducAhMhʑJapaCRM7 ɉ6ݖ-a@exppbapar҃؃p//,ً ˃tuIxyeastnd،diHen`h|iX ף)xing?tiɐA"xphos rylchold_origiineca@m"Hahr1sp`milarpيȃhumӞEpy)ucifulOfwrwillowwwethodor9i-,whpohcur(texistsdouler@xvide焘1HPvyiagn`u y.7s:r`again`h0# ,JHleur flui BXqh'Qur pؑam@inxїaddSHamlރah ,(gВzlchpatograph8emgdy (LC-MS/yup5ncept@t젒2̔Xp4뀈PgggggNXcorpo,!N2{ȳfhrix-assiրstedaseresorptiononizaZMSpectrafourry8ce8romheHbelinternaltandardithalculaisotop8distribuzusingustsoftware.
2 >J)P@ysiև(ci15>Ncorwasto 98.2 % (%CV=3ЗPsrecoefXi860.14)dhěs.әD idbynfithat cr_______obtaJcY׈avnatWWononclon:NMIJ minl3ondsamann@Xtwomxbopϕr napurҀ/'8hod@Th8ind܈recePizuitablxeɄPrologya}llxs@yield8774Gsyqui8L 9>׆Ыa1rsuqroge/Ppe`t="10pt"(dth="a>B-97(Hg`__ClassӕzoayyQu(ifyirapecZEndqousÉȀPmA-c`Pxexesu>S.͏ruscott,.׀ilkeB.ogdanov,aLhX,.ahhUnrs `Louisville,g`KY, obj3cӀPdlopxcccLC-MS/MSOOdihydro- ˒:Єhab8ȯaKhۀ-rmqEh(idm쇰q''C/rh.M}AmoTQTƵhier-ncyclo`bHc'8(FTICRp)@o-ESIapyzЅn)P8docH@)DЕP=TSQ(ipdrupoXem)[OPndrftunәh@fragA*dxynmoo(`!opڕʁzyinс`8r C18xyed-p8olumyAP6gil)HPLCina(pumprxС(1.7disoc!cluR*40%@etr0, 10MH43m/z)ith______6internaltXard5ion8linear (rpǃǃ2ǃp> = 0.995)vernge1-10g/mL.ihydralsow775usY@itR(7873ityOOOOOM88)romLC(/GKTSQave@ensitivJlowlimitˆ~0.1 selقH@#mon@rRonsA 798/651or 8014`.Ò/XnHisݓG77G7F2M0.4^,ʋcoefficiePvatepdynamic<15%onclȋ .e莱optz paramrsJmurembohanolcimprpdWPapxim0lyȒGbserۉsellecapacцiseB componsff˃HPLC,owPtaAta&especiȈbodOOogenousLIFĆۜvphogy.upporNIEHS30ES014443,SEFǐt #148-502-26NSF/EPSCoR5p-044749B-98Hhg`__M25-bxyX8n3C3-epi-TUpHapaedHradHop"u>Jzton10u>,‚MolloyKeevil.Ѕoope߁. iXׇi>W srP,ancher,ծKdo_____@pisSouȃ/osp0l׃׃ׂڧըBackground:Z m:OHDseedha@tferencpssessFuLcy8lugh (ic1ignxmai(u`.n 2006,ӆhetHdescribhirchatographyEto(le1saXstudyadЮgprHrixP2fЉpno@Morcl@NISTdidreͰhced82Wߡex0resed-pe8mhZt`etry+آ t٫ 1@soluOI:3JthiȊ wl( A_X-SFhr"ىSکMs: 156honyx62c (0-9y`s)Tsamples Nhם`EnglQwHalyanxblishsemi-autAxSPE-xibo8pla0n(robotliquid-hgy(m1barxd0orgP˓ȍ•`ri-deu@ڌ2uyardb(t(clo(r@tNar$ǃ, iens9Qan9xffppY@iHoleculс̇ad[dina `r`ɡiqI.ƻqw ifug(off-q)@!unatnsLoـOasisWWT®''> µEĔAaو;pednalyۀteserelutedyheiquid-handlingystemndhantashromatographusaatersCQUITYPLC) >0.997.calculxdean77ʼn9adBpaediatric܈14-119.6sre:iy-"d 0-3.48(mn49p90.6)醨hispopႌ4.91.031Encm@b"0-16.24% e=4.23%;4.34%00-26.52%5.777.46ǁRoy:4.89%hendiua8<1ldxcludystudU*non-!h:istics (CLSI28-A)ref$exblisat95%xvHuppPlimi(0.0732.85ǕClon:ަch90%93@HG'@ъ;ioȁHhP, 78%yw4OoulPinsu(T20.B-99 @g`__D)opmٍid+isotopeit8Hgbrysimaneousc3-iodothyrona,hx[rirHrseԶ3,3’-d:-L-VHumserumGGGBu>L.guyenggd1gg0u>,.uG,..Ӟi߁3S.с4>. NMSLabs,ilxrP,A,QBioanaly Coho`ory,eorgetownþ*ਨchÜr/(Un@rsitWashhton,CiqDet8Mc߀OncologLombardiarVcSexifTWWWWWWVȆWW:ϋϋτWϋφPharma5'wwpjgfNBackground:Biormon) Ϣͥ`irxli0_ȡϊϜw`apimporxt regZaumbbiYprosesCxdecarboxy8einsU׈.t訐)c`sI׃pWWWVAM)輀beePhtoreaht`ڏblosu@aat$gbi@ppo@"ecA郲selxsObj:goȐDstudyOOOOO'usmцφφφφAM ,sizۀe="2">4,and 3,3’-2>numanerum,hichouldeheirstonablquantificationfdogenous1AMς.Methods
:nPI-5000`emasspectrometerquippedithurboIonSprayource8ShimadzuPLCystpwasmployed. 18μL+deproteinydding 15acetonitri@cxaplabelinpnalYards.ԉxsupt[ilut}؃de-`waa 3aliquoinjHo@gZORBAXB--18 lumn (2.1x30mm 1.8icron).f9h)for 4.5in@sCmobphase (.01%Qmici 98 %, 2%Panol)alowq.2L/4, sXczvalveractivp1a yɂ0ew8ˀoRgebaradi35Xe (݁gc)64%P2_n 8084.ilyWn m%B 1X@lib)Ynext.ќ9Pmultipreion-m9orI(MRMsireriJposi(odeESI偙o":svoltagt 5IV"heZu؁650°C.ǂxsettxfols:ur瀨35,IlisI4,xbul8 \50.Ґ ptimipair,tacompouHؒIpara#ɠow:'&1''>h(7.2,/z6.2/21)'ooooi- dρρ4GׁhxG360.1@6@P=86,E=24XP=19烗烏(8.5y525.9/38x-phi>cG6ol5318oj>902635gg /3,b>rr896560WggcCGeGZ,υρυ 7B1293σ^h9.@977:34.3/____''i/ 783.8/640.2E=3721PRess:in-dCV< 8.9betwee'"637.6y(uRecoveryangfrom 92.8%o 95.4%oodnearityb仔conc\f 5-30pg/mL wwwAM,74Ъwwwr, 2.sng/d77_7ǁǁǁǁ0.6-18 µOOGON. Permhdpc(LLOD){߃gggg1.'oo5 μ??_?_'p0lusDAensitive,Pmpl@accuHQspecificsotopeilu2temass2tet0hadeveldbvalidН`haneousasuremHoll>1AM ,3r >and 3,3’-2b>inumanerum.eferencentervalsorachfhenalytesXe@mined

B-100J..reeuLiang,Hoke؀orey. Kai8Ћ(ane gxalaboratroies,erkeleyHA,B-101ȓohggMet@lo)AysXCush’syndyTOF u>M..ӑson<>/b/u>,.anDa////.,.uǁǁǁǁԅny2AeyPNZ@InsHealthesdaD,GGizۀe="2">2NHLSniversityfitwatrand,ohannesburg,outhfrica,brX)MBackground:ortisol,hichsncreasedPushing’syndrome,layseyoleQsealifferentetabolicathwnsnownoegul`predsgep.oharacXizeheiochemlngesatccurwelopaoHpenurin`usPgilA6540TOFC-MS.Nethods:Ձh 5ubjectsiXs (bee 59-1604g/24hr)6ealthypnt/__esn 45Ww@proteind50%cetonitr,(lut20ol analy08pȍby 4وoptimmurem Hhy0phobt8a-18Qehlumnasunbopo`negajionodeinqueousortypeqam(DiamoHXideDatal(MS40-1700/z10-xminradiׂ0`MaHun ProfrJ؄X sofH(T)esultBycipomponÃsis,ll7fclus)aXYb&foraxr''UZautomxdeatindщualit%ra4*7,535,0Ps䜩firshelis[d(h!m⭶xi(prxȜѩ1lanksanMnoXo3d samp.@fur@ Ȇtlyemobvhasignift-8 alue <0.05etw9t1GH%402g/S:ceAphxia@`irdpeak,nt1zirPld.Ϟ25Wiyx)%,Xoidp8(@idXglucocx.ɐ@dd,2oubiquin9doicxm(QsngZN-1ylhX@whiXha`vipXbde0ibkb(A'g3ϓelev"4p(ᙩpalowq*alsoP`ut (re@h(qS/F˒ 1ݦ:ohD+dip(@,-CyinylglycjNinYcarnҮon :ƞhr0gۓPitokizavarYb'!acӖYaphaeful:de`Vd`ac`92summarP(el}siJccu+QTOFC-jAtJ駇1igh)haHpopQcharacq׌ dxx@lu,Pvew hinЙhodiag܊}郬.

B-102ȓohggAHPanelYS{sMicro-FChatoghyԅPemSptryu>M.arvis,.eau. ABCIEX, orONhda, quЄ "group -@hydroepironeulf (DHEAS),āGGC@isolTc , 11-DeoxycA nedTest17-OH-ProgwqEsȂl using faixer,@Qbothobusible.asu u@i1scceptalinear@nH)pxie3rPatudxThpodpfy)sumpQ,cr ityߨߨߨݢqurrmh,us2 mit!gcmallinjvoluirІKi[PwaeyQlied.

B-104ȁohggEuvTwommunoaffiyťALC-:Sz1α,25-dixya`Ąu>C.٠H1,.osewick,.eǁǁ2ǁǁMza߁߁߁,.ךPׁׅoׁ֐hCIlCpic؀,H,a灘8Fis@Ӣ88JȃPA/Backnd:֑lays'@X0heal@aaariehpa(logxlؿRttmms2D3).[1(OH)o`D]:vxeHol`&E mجypngAdueYJircul؇cԯTcb;erQsHc+s.ɲ(8ЉxigaegK0e3purify 8i`~sis.Ms:߅kdiikG ( Tubede~ssay)[cysteL[hDqtibod!ad􂢌eĄl, 500 μL[25hexadeu"Z)dardMdddir0obil|ncubq60n.freea8iwPr,yl@d4̕reagalcohol.x;dd@suspenQ0170/3anol/zgyƋN@tecipfequxaceto8rihfurySPE.řꔻB,PBSuf@ytaH5%ƍ׍ӊG07lurap8c 9xs.ԉ(89Ƀуi!p<ȧ[ËnPwPhPhathyceduslbparymanuf’((چpFy µʏ +{(jȃ3|p"MRMe.hatographHsA+waschievۀednnnyxonolithic18olumnradientobilehaseuffers`nsistfethaXdater+0.5Mumcet.he-adducts91,25-(OH)2*3.9-212.6/////+XccuracyQ89.8-98.4%"97.5-115.7%,specAly.׍WW3@:8-277.9G!1J38w7777OOf 95.23.6T -120.2WTI-assayZ0raCVs2.5%-7.0%d6.0-8GWurrvaluatiHyԪouRu40xsashowaxnearemQreg=slopB0.751,Xy-Zcept84n909nntabi f (.1%.Æ;swwu eELC-MS/M(B(n=20)1.0201.329797.9%Oncl0ongexp`K%cHɱhumȬum ǰ_pchoihslicYeri8cXTixI8techniqueтzpdehPdoufyoߞߞߞߠohigheselچport!oar.

B-105ohggSNjIS0oi8Difti8MobilSroryԅem͖πȄGGGDu>M.arvis,.ylor,ě(i,.eBl0,.ӎPeider. ABCIEX,orONhda, B-106(HohggAhfHip煪y-:Ҍqm`ucsmagin(,ymxdthylau>J..l-Khoury,..unch,ӛxang. Cl dè(ic,@,H, 13b>-d7>wr)Ixncipitڋanol (0.5mL)@f0㵱ifugCat 13,00010inutes,+unPP2PxsTvyFr0.7mLل:25mMmmoniumْHek1 %ac8(68:32v/v(result!solu:(2inكЊhPo0Si-alytllumVan; ,0 4.6mm)aLX2mu(QuAccek"setpos2rospraz,*BbhakHsߧm/z 175.1->70)ȗ/7> 81 4 џB203172.246.7/oo(Ȅwv1k7hؒJIu`z5rNognXPss]observed\;ɸeov9pg0.90-80.0 µg/mL.5-994.993-97ooH,espectۀively.nalyticalecoveryangedetween 88.4-111.4%orllၺesheinears.ЂpisionasvaluatusingP10-A3rotocol⃰unn30Pplfow,ediumdighoncentrat <5ays (Table 1).oignifpntarryZobservpo 80 µg/mL, 1,258i1,059argiXe,DMAAH,spectCl:hisalid:LC-MS/MSthodnvolaampsa:p`a3JhorXhromatographyime.

B-107T.aw,.Ė,.ellogg. Children'sosplostoXEY(r)MackgHnd:irols,acdcycloryaremmonly (ISD)ftHspl*,toyl(Зahumeest.tourphbs0woiffets9beՆono)assq@einst.Mc:ƒp, 50ulwhoH+c,Xdardr!lmixwith25mMnSO4rief؉ h{vigosЁ20نanol:ace`itrile=70:ag`J5l 32-H2xyamy`20as.ӆs㗱ifu10pnuIat 13`pms3dhptinjؒaAriaLX-2hermoisHci!)Hclean؁t:Õne-P 0.5x50mm@nt8te 3pъ1iaЁ8/0.1micid:=80:20eldGHysilOLD 3ooh0.7500%V/"API-5(AB*x)qsi9/?hfd6D3ϒϒϼXǒÒ咿WU1.OL0.05''''#Phnex:˄xtexx 4.6m2.6I׃׃7:93.ԫڿ9xh9achUshaPga75'atm؊ȱheHXiz/҃:ԃay!qarpiԼnsitiy፸ㆃOƗ۶̶wwr{B-108ohggH-ThghputdLtiHmS"UUl-fastPE /MSM..omm<><">1P.iller2ۀ,..angman<< yize="2">2W.Marr1>.  WWWTB-110ogfAnnalyM PDrmՌTe8pi-byiquidÍhmgraphy-TxemassӢQetryGGGCA.atawiec, M.ar. ABCIEX,,Nhanada/ihBackground:measur /@oȀh̊!qexoon([@ftYncthleperm.aR1 rmiyp@apxiqugȁurÃHn' /(T/E)Cs2x82.0Worldti-Dop)AcQsstabhdar˃}4.09B-111ohggM-AssociatLaesorptXonizPXTimeFlasspectroscopy (MALDI-TOF,S)FastJReliabledXifBaciaaed`ricÍLyφφφu>R.erris,.tanley,.ai.tX,.cKB.ogers. Children'sealthcarAtlapMGA, s7>ƹJi9stot8(714ni8m٣xg 76u߾pzibilityi45sodepslre.w8(yieldPknow9mitĬsym.ma 648? 588 (90.7%)avȎBy #TA=;46 ((Rjo (3hu/IDGos'B s"-XpWݯϫh,lyveqti9pt`zorkflow,`lHrsx𕹏I& egciuilsou؁فteoarch.

B-1128ohggFen௘'TRAQ B. wson??<10u>,.oshi,.uρρρρӅns썘.iiׁi>ABӟx,ȚræH,A,aFrQgham,,N`bjC: )o  򣀩atpim uppН (AAA)κshorte yNXhbquahiHItlyUl@гKaL`Chgraphy (UPLC)Saartridr jstp:ǎgackgnd:AAhxlIbeenqpyinbornyabolerrorWbas0exchangKhydXo`bc81لcisiXuffersrۀomxtremelyongunimesndwhroughput.PLC-MS/MSalys@havereat incPsedamplet,roviddetectionimits,ighelvitiariehofhysiologicluidsitharge8nearynamrange.
PgallxerePdeteinizprivatansotopaIab0deagent (Δ8).nniquetertardorac`minociasXusiHun0Thir8six' Xsolv?nltraermancēЃCmatograx (U)olumnvoverPia11inutes.Ďހthempouny8ieq{ 5500TRAP`Result|Calibrcurdata36synt0uratrXp`)`~ 2.5rsmagnitudn@ăqtrolwell.xc_mauh, )showZuke0sob cf0A teak8i!difidhto"KHJ-WWTspeciH8l(ons:ensi|уQmBc)LLOQs 3-80McPacyt0@μM10Zl@s ± 17%.Ɉun٘Gwix.ϐll,7dȉ(b`teYs`y psFtu!@7ԕP/p>B-113xohggEvaluLCscbphsderium-VitĈYaboli,HeroQo@Y8cЪiHfXJ.oo(,.ian, D`ohnson,ɜ ilek,.reenhsan. llسpR0cXTX`gMɞ9dubje:/ch0ex8RHɠdeff pcaumpactoi(ncy`(Se>frePn`d9xτχف( Rqu q0o__to-eydrug!mptor(offset٣xυ(iom0medpy,tc.)smaІrppeکxestʢ*;ԇfydro(-gli!sc!ysourcIsy,PѰ25-HxyonϟϟϟϟyiXWi8tigdibi҄RinflHi t#@(`(emPpov8Z-of-flq),a؄Rxa?placokͳZs:4S4wWrsꊸUP`Xevo2-ThB0Ag(1290Hy6460Y.֔ousph ummoP̞8azdifu,Pcne‘rWXJser ʁLwaPonp200µLBddlanofowC1mhephȜ(ifuged,iow[  1>t?es8S/Yobvb2QWHJ.ex0ntOnBQ D3B-115ohggMD2FaSȈLC\NicoQaboesσσσu>A.ang,.erg,.҃ra,Hawson,.iu. ABCIEX,ƈCpA, B-116ВohggؙTestpe8e:Cis HCбq`bpLab֗hesgggdu>W.״1iecki1,¤ernez,.u8߁߁߁߁ʕA߁߁2߁߁Hiuρσρ. ABciex,X×,A,)Kai(gPXIorRichpdGBackgro:WpubZxd@n0howoXcorre,2rang 0.93@9RhahighЂz1釒wy10%{reporI gh|((=)ielqʦrall.דlso4ouypeakhe sehhub(SST)cghՊA@䃠@Xꅠdieoy8gClusji`drobustnpi.̭QuanPQ@resolv{evXlini@ڒz8@leaa{(Kablished,ȳȋɅX8`fsi.gﮉȏnst(ZyseHlarZymrؘoSIA`whѕ˜/(,Hav T·bOooPkn5X⇡&viXlyFi0ature.


T8t. I.S.B. -ɑHS&h;iHchnologisrlilaIt`؃ǃǃƋ@ǃǁNewService CPay-ToxicZ,spedaAgino-Estensodena')EBackgro(:e*xyg1p m0du0DNArwhoxfrequencySutaphar3ieHȞҝX0a jbi҈mh disclaiahum00e.-7,8-dihydro-2’-deos(T)1studiAixrkHl)itsx鈠âk1a0tuv䁑g+`!/?;zfznsiitcs*,uul ffзêrix倚ihdrupQɩxeoy 0ems( `r؆)ltrXmt H(MRMQnd@9onfew,sst (ITሸzer.אؘtifsmitiIT^@atebyp{aewdXlo(douplingۀECndACI-ESIonizat8ourcesoT0alyzer.yhispproacheouldseower?notentialuseducinghemicnoi1matrixffectinkedin-kacs.urthermoreexchanghroography, atseldommploy0withňdue؂Jdisrphenom n.
15]tert@ard.ltie 300HPLCump (Dex,njany)CEolumnԎ Elxrp,e18HILICHp(Mas9aacqui HCTlـ@BrukDaltcs,remewesInfotihfragtobtain[M+H]+Hm/z 284hiNa306 poor߂ڇunbsig.>=168BmthdyC--MS/MSanver8phJaetȄAlimit,((lu,10.1yauaXҁ333.Ƞ@8rȟw+],lo`sensi@ityse -fo0$yy!uo)tin!ssomin``cum9piblyA Qxsatu4xaȂyڈ#havam!xBpar@ץlop0anm2UfKhigaffiowPs‡polarmpound(butvzcyt`-e weagrH rotoؐl :opڃဨnoltagehI:ondwopeaktim(RT)+1Ph shiȋHS]hXтЏBosbRT֏X< ethnd`n hP ҙכ/!betwe Ks.ConclonQfaa0reli:[?ap@9Ɔ.ӂÁhcouplsȀB(LQot(s)cmiiB-118Xxohgg25-HydroxyQ3π21s8UJQTRAP® 55pTemSZo؇MPX™-2Ȅroughp0MXihx(System???J.Ìpeegler1,..ood''$2''>. ABCIEX,ƝXC8,A,aFrgham,͂br@)Mbjve:Beca]+enѬ؀HX.suciyYcicarch,egAuafo-birkeravcresubtiyYea@i,obut!0h߀π2 ٢dsu8/+t"0aiquihsdSmQQry\(LC).Mology/hϦQ·8dacalȽ7Wapabil`LK?\XȪaLJǢwohb߆noopburd`eKlabootaffm~yh* F'c-prepa/(S_ɔhtyfXpikπȾlysangaf 0.5i1ng/mLdotecipp:fobyentۀrifugation.heesultingupernatantashennjectedno၀versed-phaseiquidhromatographyolumnhere 25-hydroxyvitamin3ndπ2luyusanearradieȃOHicethod[ruimeratalf 2in0s.ithIeـYMPX™ighroughputystem,sablebXcPr؉ y 1.3>
Tuesd0PM,uly 260Q8Ȃb>PorӑЋ  2:0pm - 4:3QXa8 Nutri!/Tphes/Vsn7ǂ?>B-119ogfaboostatusXBrazili0 ng:hrveykT|u>xM.oaH
,.Ʈav,́ouho,.arciFa. Labede,eloorizr,2/aԁ">3>om𿠥ithstudʢizXpww$aNUg,mpaZite8 a'orlde.ƺAhods:X![t];ughhemilu`esc(Liaison®,as,S)7706loo(i(wo: 6087/n:1619)8lrSepte2010Decňa(zӄ wderivefX:먲 0@midwereg.yrynX(hb w 10.0g/mL;ڃ3&s@sPIinsufi(up10/sp 3st(sbi-squɉptsIΕ֙i5.12%.trshmsexؗ7p"Pwomen (12.ހ30%)hannen (7.44whhonlyegedopulationasonsidered,eingRdiffncethstical8signifhnt (p<0.01).ԁgeneralreval2.17%youadults (20-39ears)nd 11.26Jel(≥ 65LKtwe(thiswo)roupsobservbothexesachieهlValuЃ1:3Ing/mL0z74.25%fgreaterwo򃿃simila <analyzed.
B-120`ohggUnٛmoplasmaX-OHz2HmmunoassmpmpPr@try7774u>L.Pˌng1,.h-Turkmani//,2//A.hkrh.awρρρρυD.ellog߂. Child 'sosplostEMA,yUnisit*Mqchtt Worcer$)_BackInd:(ergocrol)s trS`ph ㈌8/.PwV2010eVExualIAsPstchemDEQAS)(D2+D3ppțbeqXsaȆIaiDias̀Ixilu(escLiquidhatography-Aӟy (LC-MSMSSithxsed,'9آPaediacwn.Ԇ(objQvhHеlRco i~Ǎ:a̅e8$ bo Bٳ.oMsxoloyR.loayzp(A’睤Yeaci(wc!fura[qgcbdй.ÿ™yni(avygthan ng/mL72,r/)50%N8WWRp97؂(13Ad 12s)3romde-HfiymeQɊH21.5(sd=13.100.2͕7835.4=9.23.8=11775,Kǃ22.0.6^difbetwe8twoMOJ-7d=6.0)jW -6.73.9$,hich4xiXsigncah(p <0001ђa0gq0.83s96/ (*2̜ observ48% (n=1@x0Φw nh12ҒRps蚩tyC-M SMS.hisorrespondsoositiveredicZvaluef 25%.mongases,hPwasero.
B-121ȁohggV6Bin:ProteMod0y>-BoM rpDenyцrshipσσσu>A..erg0/b/u>,..owe 2Riccia؁3Drdenesanaa 4G.(lln,Ankers.enger.arum hǂǂ,ҥadhan,ɑ؁ׁׁׁׁ. Bsraeyacssͩ)Ce,oston,A,oooooHarvSchoolx灘Machusntu TechnologCambridgewwwshwwwtG@iHosp8#)-wBackgro:ufi0oubestiPbAhealivȄ(eopors-r0fractuPvgx1R򧟃tweecircuX25-hydroxy(25(OH)D)Yت(BM0hahyiel9mix0ult(bp(DBP)majcarri 1T,y`biictiygiypoIat8ioavailablewZomĀЁse`buak,ڏmost glssowi؄aņ?8.oM ods:amo 49|ygdnrQd!habolAbnoritge-AgxShs (MACS):y.umbapX"was(8@bjecusqduPX-r!bsorptometrpClp,iet `orator n(mBBalsoa8i@th9imeBde!(+b )- ({dap&Pouqz:wte)"ӔeirVfҚ:notѐ<(r=0.175@236).`ras-w𤰛ecor΃J413J003j,412keBremabxepe(nt/(@0arсgsimoddjuXsex,dyH1Б3)nclon:ƊҠǠќXcohortae3.ԧ+simtaPac̔r deE.u>sinuxopldzą@4outc`B-122PoggADVIAÔaurJWWT1mall>,.indicino1. B-123ohggMPur3ascorbicihumanlasmaAliquchaty-tem setry///,u>M.arby1,˂Kloke2R.HlRPo..heryk. Mayo͠chLaborriesndoveMpClc(oches(%oBackground:~C (ǒ)aPholu!thasssforhe  enzymaticmidHonfeuropeptides,roducadrenalorȀHsteroidormonmothe`nversocollagenoc,ndormetabolismyrosinelate.itnsowerfuleingႰtrx xplayrolenipv.pecif8examplesclude:vdet0fyZzliti-R,strfreeadъResertorɆttiUEblockŋ@Kcarox0nises.Љ onged` iencyleadsIdevelopmfcurvyiseashharerizbyectJsynhsi ultTfailurBwouhealiVtooth'upt̔apixri1Earlymptomsayeakf gu㑐tss0llAstbreaachjointXbmuscH.
2p:hГtprovid쑙reli,ighroughputwstry. B-124ȁohggOʹz\1ntiЋ ppPerlxubj8(IBELFRAILhort^a8 u>H.kouar10u>,.aes,.livie߁߁,.eumJgryse.auid߁Ciq UnipsitaiSaint-luc,ourƫPkXiochem Laboʺ`bruPlselg,DŽDŽLjaDŽǁIitute)Heal SoUCLЂuBackgnd:InmdecaɠPpxyohvWesnorlllramhcy8creaseaoXxploB0cn disYsD).srtAclinical indings,heresnmergodyfvidence0atssentialraelnts (ETE)@relatedithomeD.ef(AvaluesneryderlyubjecPandactor`ffy seontionxnotellocuaed.Ԇforeimsath(stuwto: 1-e`0ccuІgb؆popuPH, 2-0tify mmonaramete7770.
%1Ր:IBteskdep vуPhIralso'|xـPSiutlinDpX![Hisr Hz@s0ti4ڷimpa-requiediagnottٰ)ciуbut;uх聩^shipxD_c.mg؆="00108"hign="l"et="186"dth="400">VN

B-125pokggMur-reț8 lpha-phumP(Лli(1atography-yemSu>D.arby1,˂Kloke2PLadwig.elRosso..ËykiX׉i>Mayo:LaboorAndMA,Cic(oc`NMBackgro(:itamA (,)¡Ht-soluH,thyʣ9o(fun a (adapСdim0`HxnecpaPwșidif8epsuQ0r,boredu⁓embryo@velop.st⽐btaa؆dieɮYdYHylH!beta-capeneIyAЭrofوgects9immunsp@8ea:qnc0susceptibilitoAHguEϤʐOOOt trinorإqnaq iHhanalopipneuog.weliI`HioxidɂfreXscaveng@t grunsatuplipid1:S@commonpfioilӋ uch8erm ,owhzpinutsg0thody: ȅHisotsQϕ-d5X-d6)rddo 50Lmrnٵ9ardXPXwnh Rimix0(xXieacet8lA]lMardse rextractediann-liniontilizingigh-throughputiquid【matography (TLX4,ohesiveechnologies,rank,assachusetts)ollowPbyonvenal770and alysisem킸pecteter (API 5000,ppli BiosystemTorontoda)僀pp0withheanebuHsource.ɀ`Xnsiysonitoriheultiplee(MRM)deem/z 269.3 →r93.1rll-JHti,s74.4wwwr-d5430 165.2pha-tocopherol6 171-d6. libr8rs1ofixardlygIfh 0o 200g/dLGGJ30g/=ga.
)ield٦Qqobxvp'%value =@9824*(exaɖ R2B-126ohggChs dciMeasxPundAhbicdi???M.£HommeGGD1GG0u>,г.ـ0''g'&,.ordׁ׃ׁӃtel߁߁߁߁.akowski. UniPsi0i@nia@oslesojCA,IBeckmao(er,rehBackgnd:irbaZДZc\(iCa)cHa(g`i lyll@jhocincsxmortTeȂopul.hi0tesgO)moshologHevaessMhomea,tXoWTusuXurrog@.ebwhelmBarriئ esp0@thz*yځ(dogma{becauscXੰvPpHmu(obx`Ȣ X .bjx eurpotcwH@lxe:extYwhic "c߃܉J@de@h8he`Uu.Qswxy-f amprcoll[Xhbepnub!Xomm̃Zha떨n-hd٘hI@abolؕfhc.ӅㄻpSuncappH)idȔq؋ٜova 8z(Bi dy,alxm,A)Ccorr+؀lno`drepe:ey 20inuorwo  hours.heubesereeverlacedncenYHuncapped,+ 0.045o582 (meanS.D., = <P01),two),ithተage&yW 6.ncor@iiCahowXHtatistilysignifxnte(1.180.11逰1mmol/L,{5)hilOOOOOFO0K202OONC-r chanx)bo@0Vwwas)6p2J!p3t,sphively.ɎdditiXxexamin`lceplsͅtrel .HlXndowс Qfou0th017ht 250tientsrrema*i0`ref0inter0-9pOfhrewhobelhal,adבtXׄy6 AH85’sOgggceed!7p234F9vbovA?NampxIlodutechn"difieCl@onRѝǝǝnjVser0C(eftotemhatu@ɱj8s}donoЀaohtaϗˠ0ٟstudyugg Bm cll@or`ettns8popul@ȅcarriᚨ#aerobicHn[Furpud0cessa蒙ertnlx@acup8t@exteitİ8x0cy,lPkhyroi8tomoPeiv9blooroducPlack-abilitZmetlizit.

B-127ojggALOX5APplymorpm a@yatacidnt healaucasiansu>N..eir,́g,.ٔsai. UnrsɔMinnesota@YaQMN, B-128`ohggEssiXm ermatscoBBelg`pulv80ea1ld2ؓ{u>P..ler1,.aes2H.ekoua߁߁,.ĉu,ʃȁgryseς.aufroid. Laboory٪Z8pbiochemry,liniquUnrast-Luc,éatholyouvxruxe`sXum,ׅׅ׉qׁׅIpitutHealXYSetMBPgroundfailu(HF)雰4hprobxhtali;biduofea#poph@fun .ytrordataboeshipHtwee(ETE)9cx8hdiovasc@ris (espel);bipublishedree,y(p PyecomdDimu{yډHfollowq (Chromr52ob859ipu63,anganeMn55xbdenMo9SnQSe78h dyV51Z8n66)evaluPioьig`*r>Meds228!5680ts懐BELFRAIL (BFC80+hpHÖXqt,bservral,n-bȑsӄPsubj@gJldPthreell-circumscribx80<.Ɂpo, 29rp)Qask @lu }N낝,wqPsPdynamic ȄQPs, (abijmultisystemppachPnexs iau:e Aia,pУ@1ed@r8cygUa^(PT)zAt5ipaswalk2peed,isqahhuttaofKha@@!albt8sACrXP0 14 (VaalMCNJcs 2010 10:39)yla dInduCoudЁMHӚe (ICP-MS): 7500riP[(Agitechnolog aнarXUSA).mc؃pS-Montte®rĄP)Stetd®,A41(zat -80C°x//͗g҃fn׶PTǃ9(toPrvbeo9BiEthC@iPo)dCalcӽwQ(Makerkh)蟀tڈResljshowQignif(P<0.0001)АQwwr*sameonclusi onasbservedithn (P<0.01).tatisticalignifXntelonshiptheTcorenoto(rsTE.
1.ternberg2Chaudhary-Webb'''''!Paliakov.̆ chleic. Oakid`In0tuteorieᐡEduc,lITN,iCXɃADiseaPtrolPrevAAAtla,A,NBackground:n@ndpreanalyfacsxchsxquinabilQke8nHtЂفidab@ysults.eeompdH؆裌Ǚ (25OHD)1varioumsx>3GFbǁǁǒǁepi-烧asr1erum/t5.׭"_raat -130°C 37Iabtim̓j0-476_e0ds:Ƃ|isbloox`collfrom 27dyH-topkubPno0ditiv(SNA),,se |(SST耀dNa-h!9PH Pait-d1fiQnyppirs&Towe4>7(re̗9aonHtwo8sahHC`M7-90mol/Lw9?44ek233a&8ayZduplXmpqsakPoughout.Ƒϕbassed(IseÇEfour76Ąwȇ8z.ix8UmodeluSool--q*R @hangqaculafBɊir`urplpAb(n=35)مmipw%mp8atȞ̃;0]1-wayNOVAdetSamh uslid-;x(".yrpȱoЀiluIHPLC-MS/MS[?m(cisy(CV A≤10%߅2≥2m?ҵ:h({-0,JPHjX kpp>0.05NeP9vn`lXloR_Јq:Ӭb\d @ؑ˗cy.ONʼnaȗkumincrp!ob(vzlikQdusic &sX> 2 ,..elch<2E..rank1>. 1)9(vs.;)6118ţКabhe܎!8HeWwh (CV: 3.7-11.8%ПhpdyρB5.9-13.4%);reP)߅(sel؂! l urimcoacW#π;Gstra-bceptzero.ɩʰׁspik1ËPthreXot on),cuQromuduhB7yx9.7%, 4.9%7.0Ht 1.0,1f!9pv.ðoh8ߊo(~30%<X1%\҅pserum6Jdiluwisne1g 52f &gX500g3PBaꄤ\twoceduPielde`/e%11x -H77Ƞj999,ӨǠ'$y/x77b07.1.
< /br>onclusion:heharacteristicsfive-pointalibraturveoritamin1 B-131'$p>,.ipton.aleׁׁ2ׁׁBak߁߁߁߁M.enkins.auffma, Y.or8ni''$3''0u>. SchoolPmacyexas0chnrs SC,mlloXMe880Oy &ӄwwwwwwz𚰀(M`ckground:֝gggehabee0ssocidaumberdis0xsu tdevelopʁ eoporosis, crdiskfHelderl8deeimmunxuncboxpaiX9des!yBanemiazneurolog[tsǂ$.Obje`vepriHythatudyoױXav ?߄ߪ??0_oPthods: 27P nlatDeOBGYNealxS„Cer=ɽMa1ludg18-55-ol0ho4-8Heksum!xnqtiXausasxhXP8askpprovpwolood`l؂a؏eirirmXtotXOOKm` hwhibtPHHtlinspeciSos@bnaIIsMinturingqerview.!s8san 20g/mL20- 29.9bcons rt,ealy߃ދx3aboGXu)0_wesultwruxd+I22gvailable (gr 5_aPpendH)//rangfromX6)1104<(r: 546±182˃ NтG׌ׄ11-45.ρ-, 107(46%)`(30;8,41±3cAllbut (.mځhgula0aiXbagnaӣn>nߛߛؓoo:sp"87%Vcor1oǛׇim0ref8aRptm(ne!ddiY߄RattaaݝKloGGcoudu9ߩuǁlгlismgROu)imQbeca investignoʹs??(mpac om(fetus/babygdbظf؀.ei8xԎ߶& itorhe revalencefitaminndvB12efici@iesnost-partumomen.

B-132ojggCocoaonsumptionffectsnloodressure,xidativet,etabolic0ofilebiomarker0f@flammȂendothelialuncʇpindividuals8th0age 1ypertensHdždždžL..ogueira1S`Argol//-3//0uR.ӆTorOOOwSanjuni. Rio0anotatenrsityisciplinZCHic@Ex8i0tPathophylogȂׂ,raziloonooWWLipds̞ratorDiagnósticosamér__\abr)Mackground:Rec`塠suggesthat(eǣpchplA70%decreaswqwh)imxv__ҨϨ.Obj`:aluQ?=uI//a(taknasggluesm,ipi!eWWWW.Me dsntervctrwyoutviou9ti_Xat1fexePd 18-60eaweHincludЌXastudylls򓘃 d 50gooh/day (tang 2135mg`lyphenols)or 4eksYvo`wur鄉Jod,gpucttoduHirabitienergy-280KQwxsultw>omparisPpostgavedgnif8epystjϜ"drom 146.5 ± 1.3y136.92.6mmHg < 0.001;ldiaeasrablyl93.20.7a87.48\U3.כbsqdxa,owroَ(`wpla(ߛڛWW:asculare0adhexnolee-1 (103744s.10142ng/ml),)ra:(1x24 10 E-se`t(687A 6r6;gggHhȝ0`-ȩzte9j.12mg/$leucin-6 (8215p.OMA-IRumltumnosisXor-α;dDLƊAi8tolXeroPHtryg (drem(qlmahanǥ CoQ:(h0C4+ohٚ

B-133 ohggAs@sمIodZ ้8cdre E@ernepalu>A..u>,qD.hta,.okhareM.amsaXN.arB(0oiatuHxSccD`a0, B-134ojggRapidHЄPpribofl sHPLC0thluo c`onσσσu>P@`ang
. C`in)Õ,'spspitMPc@Жw,H, photo+yreatP(8ja(ice.͓lp>hwAevhthatWQ8yefu`ddi o(witheta- blockersnhereventionfigraineeadaches.
0.95Ñ(lonЫ~`+(7yellrduciPitI0no i}exon teppriyohXg hwZPaAG.

B58XohggEJylbX۫jerumayneOOOLu>Y.hen,.iMJnez.ADivsXCHBiochtry,ĭtL_McHr.ŠittalmgȂxHospHorizhHealNork,Ƙ0cx,B,Ìda, 1FNBackgHnd:at-я!vhs,8)Pral@ Й8hpun(ambiokwؔpoxy.تQHudinHYuhobloc PHigncsdays;@ǀtaLrema0scaimudyBex!eeLj_ǕǕǃ׃ҢMsivЁjpoѷadehby𥸒Ѯl ef ?@l d2.50 - 4.27 µConclus
:Ӂ_oreHablehen 4°C (darkr쉡)QfreezHIupo5`=ilityhlsoc񃒌׌׃r7/'3

T1:ercentjg% (SE)!variousOs GGGoo#2RTςςςςςςefrig()poFroz (-30iggggggg7g߂߃πσσ> w>D`1DŽς2 (3.25">-3.77 (2.310.60x.56.231742.54 (5.07ǍǍǀ3ǃ12.8ς5.9294.081 4.7߂72ʄ'ύύύπ7σg.9p3.9gݙXׂ2.4498.3ҟ6ύύύπwwwV0׃1.913߂ŋ18)*'''''2379.8„(,'4447888''''63ς.6pt"idt h="0pt">-4.93 (4.21)

B-136Єog`DeterminationCadmiumnholelood:Åis3ProficiencyestesultsIsoeiluInductivelyHuplPlasmaasspectrometryυυυu>K..urphy1,..uthrie''''&,..almer2MVerostek Gera0/,.ʆ rs. NalstitiuteStandardsndchnology (NIST),aersburgD,///ل//WadsworxC er,ework1xDetmHealth,lbanyhY؂6MackgrounRelssuSRM 955coxicle9sCaprin,ur-leb induse eungheccura8 measurdteXyiw:.`rtificonrӃes,Dhў!icpordQepCdQL1s 1R3asDCP-MSm ``(PT)tArwecollbySDOHҊHdssXHfphQ\24.owddXsavXe(Ql ena2(, 3؃9)twPTˀـ.Methods: /!-; (1.0-o 1.8-g)Qm@x*iah%asaɆspikUenrichpww=1OOp>C9diqurityNOǂ>3b>a4remicrowovenowу؜:𹤋񇻈retaapysisBunsȂ"8Ѓoffusnexchanghatogra.ӄiXro00XoTi>imembradesolvxr)mmxideуP.ךalculb9珧/Sooׁ׃ׁ׃4zsfȡrr@apidu !lM؅Sj66,ONBovF: qiP)/u>Cb`psY -Ӑle,Xieach,distribuU“Aal”+s߂zʝ]`annyoupe`i88Aub-set5,zo*fBa炸p22XPwlabo@oЊq(18),8iturna`bsorpzoy (3)???ŽYGBT:ׂ(i-0.9 %, -3.38A-4.0 %Vg2 (2.16 µg/L03 (5.204h0.2 YiTapprإheP%Xnfqr(difOXeanPhowxvȔagre2D,owXrdt lyxgnifhȃras(.Íg׊Г'#w4͟HlluYadse儐cbrixcisaccuyqpiBxV’D10.3ԀǂX5(n=8kdiffered y +2.5 %.atrix-inducedignaluppressionesultin 50 %ecreaseintensityornseparasamples.
B-137 ohggEqielebiochemlmesblooromhealthy derpopulunivhospitJrazilu>N.um<><">1,E0endes2O.ʉul3Wcobilhoaiki߁߁4߁>. CLabooryiv&(;i!fdInvestig;(LIM-03)HdhClínspaculdadeKinaU Sãoaulo (HCFMUSP)Fleu Yude,o,,ψψϐ9ψρ)χχχχiχχlilǯcscipʆ77777777777776p77Intu8esquis(EnergéteuclePs (IPEN NeutrActivN_gg`i_Background:h`fewLbout)71в9\l7t賫\.9a o@gu"e;eomeco`ssxmbaeo.7Methodshstudy(subpY1approvhȆH`qReviBoardhRB).ȃv,PcMdڕsoch0diseases,S.gN0}Schoolbmdp8hd(dualsbdnENIEURhotoc(`opeanЀi A`125׌J (36eH(89pnxaging 72 ± 8`Pw"z]xfxufastx@avenipunctu@ussi8stНhneed.tWR`twoypcubVtaryms -芀DickinsEUA):STI Advap elclot៣p pecifHWRJhein aliquumH.0L)jXnsropflask (Nalgenefreeze-d@h mHR.tAAӛHl(15g9irradQtIEA-R1؛rchsogɄ-hShorȈ0lo8%carJ!harX؈SfluxѫS4 10DzDz12>m-s1>Br,a FeȀ`RbȔZnGAqdecapimyfQvmxaȜrpYGtrodGX2020uxqgamma-rș#oisFt8)ccordᘐiralf-lЅ/ rgi!_hc)+com 3cerLmriaPNIST 1566b  Oysterissueasnalyzedovaluateheccuracydrecisionfresults.
PP (ZiagnosticsmbH,annheim,ermany),singp@ficitsrom/cs,Xo.:b/+uracid: `\totbilirrubin:0.72±0.29141±3EK:!0H9.41i5.0XPa Mg:2.098glucose:90urea:37Actin8@0쒠10p3lron-dcapty:3041ffe:17854 ηg/m6prote7album43choleIol:2136uHDL-l 51vL12Ȏmriglycerides苸6AST:27ՍALxa1alkalhosphata7GGXáPlon:thnȀdႀblooderathisealthylderlyroupoots(eienorxces@h eem0sXaramesugg(nestablish7reef;.

B-138 @ohggHepinZnmodiJ.҉k1

,.Xdláčková????>,.iselt.`n>2T il3Djd߁߅߁. @iX׋i>CharnivHacxfd0ne(ilzechpuc,I灘Braunvitu؃ p5Hl/Backn8faeyy@gulatH!Оom.ϯs:cellpor oa`sohkeptsnavailerythiesisynAup-Lby+sؐ)inflammon.ĠavЃXtempairanag - ufanpa,hi脐causcyacH`"teɋProxher8ndue1de) glomerЄHil:8e.urimaڶ0criPrehXshipforڏ,׌ҋs thods:Xmpl \ct,,ּyasr!RP!bumqaJF(ELISAitDRGgnostics),@lxranԈcQ(sTfR)IL-6؈asuaٶ(164Ot+cn8YprogṓI''$st>etrIn0ni (@ 66±13, 25-92ear633101c37ntrolXalthy55±201q0G0s0@IjW mosignificantlyop (p<0.0001)y\@H5/p=:3w7akp|,o@xcorB`withVineg(RxƨWHo.Y bioclo!esshow>)s:Ё'''''ibetweЇ''snd  aontrolroup.nlyeakrrelationetweenepcidinnderritlCRPBnoρwithL-6modialyzedentsandicatehat(efluencefjammasactorusingcreaslevelsis`trucor܁cluPxretend-stagendisZcur.

B-140hohggSt4laatAciStt C..os1gg0u>,Ț0hen,.bergӁ.o2R.̂chleic(ll>. 1CDC,tlanta,A,ooo>2oojBattelle{br()Mackground -tudiesavehownecreaserohangenheolyunsaturatedycideofla/serumtorPat -20//,o>C@≤10ears.hisudyeevaluXsstabili0aanelY?sQׄׄׄׄׄׄׄ2hډincludsix(SFA),evenH(MUa11gPgds.Metho-"analyticalstouitOc@ionsasmodif )LagersPtPoleculareneP0abolism 2001;73:38-45)otp0ereydr@zed,ex-exHc@,`rivp afluorobenzylromidersdeteingPtrcapXeegve-gXch0atography-maspryÊmprecis (CVbߑߑAߑb>)򚩙 2.3-5.6% H2.6-11.1ۀPripleialsthPQCo؋ //WW/W-upF;q im@smov僧h-7ρρρρCatchsXhe(0;.×GEY7ττττɈcompa9witho(̩inuousl07777>CllPairmosph.ixeff@saJ aӲrthwaiapproxiPdennr`g@SHd9Vل-by-?esul-gnori 鍉,И…signznt-de*icPa((10%)h77e6 (p<0.05);QtMe8i aWR.ɅꀀstPx_______s noӄcrou(e ssm = 132aysHAssoci{betw)ςnumber1doubleonAobsersugghautxdl؂-Шz؇*s 菗'ϊϊϊϊϊυi7L+"s4`uldhTtemp9QaddiՖrtq/…p#Q0Pସz9l0. a>B-141xokggDietarylciumak#iPre8hipÁellular,iposity,Po8rofile,loodxolun T..erreira''$'&,.҂"Go8s/////Ē.alençO''''JL2RodriguO////(@Nasto VZArgol//-2//0uHJ`o@eWV3WWGuedwwLP*Sanjuni@RioanotnhrDiPpICHXEx2PathophȎgȂׂ,raziloonxooDiagnóXcoamérh_____[i>< /small>Rioeaneirotateniversity,ipidsaborator,razil,Iٝ-herycyx4ل*dmin@hpmicabsorspcopy.ŎǎƆ hperi@r(ar0ytPA-PAT 2000<<4fosize="2">® (ItamM؆)esult>Є(icip(Yclifixo 2禘p@accorI)Pirۙל_p(G < 870mg/dIB >)҄Pznognc ?0ͅo򓀍9 ,`lcoholweighBBmPdexahircum-to-hipȏԘgbvariable(CRP-S/Rl!wwcenшre@pfppju foonfyacia8740.60153.12g /xʏQ977A55BcssxtghꌂQreya:ב?B (1.67±0.11.99r7X:totIer90d֍״woD.ɬOOl0rAm,X082ophQstX(Q(2P6 97 16.48mEq/L/Cepndail6G?mÊlonfPxA)suggаh< oooWon/eWednesyAM,u27@d؂b>PosYS8  10:00m - 12:30`ha8 CaacarkersW>C-01g_^UtilS:H-SenivYTropnԐ8crQ{bovascRisk Outp@T`DxeteOu>F.itagawaX,.uzuki2SekiguAsano߁߁߁߁.osKuׁ׉ׁ׃Akiyamw,ԉpakuiʩШ(dׁ,̓it߁߁߁߅FujIhkInak燊Itohׁאׁ.shii12ggbDivisionQEndocrinologyndt`lism,Ć`Internonqbr)Migh-senssayorroponin (hsTnT)킐stossibleoeasureoncP0>5-foldowexhan(eimixdo.evaluated"utilQBHiskrkcardiovascularisen 385utpsiXtype 28abetes.Qults:erumLwPdcY(lAv2g/ml)79.5%,14 (uppreferePӂz19.3%.bspr94 (24.4%).u@gmЌh-uperiod12핈hh؎he 17{ev.ȆSsll`oci@@agtBNP>qCRcystnÉlbumin/creမ:ggb/e (TaXOnxstepwoxpghjaysincludYpcUabiochemvarlePqu(iX"indepe(ntly (P=0.0003)߅.IᖯGmpb sefuegꌸǚǚǚbpXȡH`="1"(lign="toptrdpept="0pt"dthc>H] (k/tdggggc1st<3(n=101ςςςςς2ndW3-7o133r 7-11w784thOς9ςςςςPYue/t>Age(yXs60ǁǁǁǁǁ6ǁǁǁǁǁ8ǁǁǁǁǁ73ǁǁǁǁǁ11'M (%4.ׁׁׁ׍l.2ׁׁׁׁׁ5.4ׁׁׁׁׁ2ׁׁׁׁׁӋoUemoglobA1cǂGGG.9ρρρρρˍǁρρρϕ.7ρρρσ7ρρρρϋ_߁߀|BNPׄ6.ׁׁׁׁ7.7ׁׁׁװ2ׁׁׁ׋9.5ׁׁׁׁף'π-sensitivityRxmg/w0.3ׁׁׁׁ5ׁׁׁׁׁׁׁׁׁׁ7ׁׁׁט4GGG|CystatC?p󀀄">0.63

Pre`encefardvascularisease (%{1.'ׁׁׁ׋0.4ׁׁׁׁׁ4ׁׁׁׁׁ43ׁׁׁ׌瀏>CwreventOρρρρ3.5ρρρρσgρρρϞ8ׁׁׁׁׁьPOKcolspa6"">Datarexpressedsedianrerc8/table>C-0bh8g__MyelooxidaanБacropoXnxsthhestȁsuspicio(fcu(coronaryyndromeu>J.acek,.rož,.hotská҅okyta.refil煷. Charlesniversity,ƍltyAMcPilsen,zechepublic,煑灘-HotalƀMackground:͖(MPO),roducbytivdeuhxmacyag8`vulnerqthscl0ticlaqu`cPbeeteclaKervXagnosmarkerbeop*0is(himourtudyhtoshaviX PO(cTnI)ǝadmit .Methods:onts (bo`immunomicalrminnrchiy 20,bt)ePmeasurK57(ȅge 66.7ears,n27-910y,OatDepartmInn8{Y;reeamobt@e؆issI(+胸n 6-8rB)flly 12-16(af)g}C) dividtwoXppGA33w(aii#Iconfir𐐐pdingQ“uj`iSfMI”#lp24vxzaexcluurX{leveȄmhOOPs؇Pxhj$alrea,1104.0mol/li(Иsadudecdurnext=҇ 376.*,C 212.9.han9reYHyofRlowvaluwPсK`dB@: 0,70; 4,77;.36 µgJ20%/aut-offȁH(0.04|ŕPόA33%<0.1;6non8onnor (25.atie󀀄ntsithhestainndoutIadenerallyowevelsfPO (mediansnamples,,: 179.8; 227.093.8mol/l)BtheirTnIoncentratiorcreasednslightH~|0,04; 0.0728 µgX.otal15(tiHs (62.5%)normPdmissxe1897(376>2504;pr؅@s,"qsewereoIone〰xceed40.valu_Psignificaner1comparis9(X(p< 01).
,.orsX,.ěeaux,ďHe-Ansdell,.uyatt,.pie,ƙpookadam,ӐlMcManiؐHamiltoONan, thC-04`g_[SaLXBiologariabilᢈTroponin-IeadRCHITECTTATȃӖ\erop󀀄onin-Issay

J.oldberg,.riarte,.rostko,.ƀs,.avalicS.ebbar. AbbottaboratoriePark,L,1 *z*߁߁2ρ>+)> I =/ׁ//q/PT10oic t`der"8l="toptrd ??????>rProǂ7VleԒ(4--gLH䂏7777777???">#ISss`Wo___\24ǁǁǁǁǁǁǁǁǁǁǁǁǁǁǁnjwwwwqMeanspg/mLߠǠǂ???;1.887777775397Analytba??80.4

nsiiԈ-Is8endeth8lxlhbrelevant.1.rrG,iologVa Fromrincip"opace,ACCxess 200c1C-05g_XS_ Cardiaceasur*Threeȃ(-S 8sGGGDu>F..p/b/u>,.urakami////.,..ians؁.erρσρʅKaczmxkBu. iX׋i>HennepCounMedCxeriapolishN,gggكggBaylUnr_]Dha0TX777iA77linia -Ӭ8sco,{CAo򣱫histudypXqrmi@bv(BV)ocdf0}ue () `ch_UcI (hs-cTnI`:lood (b)*collQ12nvole (66er23Q54s)z(b4mGAmsystems:eckmlAccIIiempi9iVista;bbottϥHnalyal,൷Pù0(CVبxߔ>AbI">G>; HlyȾcul*ڕ~co1@n=60`J)tw+fngגЗsKsimilar8񖟖_\,򘨃Xhtween 44.50.1%IPHa!!jYm348pg/mLWɈlu9,sroe@؟ary們whlabooHȒcHixne oxHg! ʂtpP77ducbyhlHstH0??=detectio󀀄nfcutendhronicyocardialnjuryomparedoindingsithinheirespectiveormdividuals.

Analytic&iologVariationys-cTnIssay/td)rdonWWWWRbbottBeckmaρSiemensCV-A, %13.8ׁׁׁׁׁ4.5ׁׁׁׁ׃0׈GׂWR ////7-I7W5.2ׁׁׁׁׁ6.1ρρρρσ2.9׈Go70gׁׁׁׁ34ׁׁׁ׈3׈IndexAHitggggb0.2ׁׁׁׁ46ׁׁׁׁׁ1_RCVg5hׁׁׁׁׁ4ׁׁׁׁ7LJwwwwcrease7''''9ׁׁׁׁԯׁׁׁ׋7GGGVeG''''">-40g߁߁߁߁38߁߁߁߁߁6___OverallthinubjectTnIean,g/mLBgρρρϗρρρϑT/table>C-0`bh8g__Themparenalunctionnefficiency!N-termiIproypeatriureticeptidementrimaryare.u>P..ollinson,.aze. Steorge'sospital,ondoUnitedingdom, 2 years.ndividualeceiverpeorharacteristicurves (ROC)erealculat>ejec ɀIousariable isplitQa.9eachgroupO.n׃֋`lesah`o 40%consid@@obnor@arean (AU鏭.787:4529)?;ׅ93921548765003)Z297287IcH’|ڐutolaplargestffЁPseؚlyouhl@no@flu-ge.էr ilyef decisth(hold{mX(seȀPitspfic' (3g0.ƊA/(50g/Lscriant)6߄y358n = 16ׁ9@5x209(ׄ4414619631561(2߄߄873/7|498߄8H64840)oncl8on:isPitudyhYat铰i΀uc*agnoВma|NTproBNPXasurem8bQA?y.Ȅ h indicqwmacceptable.

C-07 g`__N-8!lCfragfGFBP-X0markeIrtisksmaj9dsarcv;MACE)ܡtQ hemiaT@.olovy81HyTLtd.,urkuxindXǂǂƈǂǁSchoolBiPgy oscowt8nxrΔPussianedeoniyPirogovMe1lqHennepCoun؃CeH ?IMisota,epartLaboorLhPathapolishN,ҸNBackgrd:x)kmerPɀPregcyssociPlahote A (dPAPP-A(Qcr@inulne󀀄rabletheroscl0ticlaques.husqsmaAPP-AasuggestedoesXaarkerorACErediction.owevdTmeasurementsnati`’slooreomplicaqbyownalytncrondeparXinterfere.isnowXYp`epecifllyleavingGF-bindaZ4 (BP-4)twee`minocidesidet135Lys136AmXN-聰alCfrag{(NT-T-witholecular`ssf 18R14Da,1tively.ׇuppothatqgYreIfromulneAduc0H݊"agecouldrisk8sessi?sH mergItsymptomZacuischemia.

C-08g`__PrognostHUtyC;ÀxysthnÅ3BNPponT2MX`AHtailoAdvadnImpairwwwtu>T.ujita,.ˀhgawa,huno,.shikJ0akedXM.aitHamoqHaruse,.atsui,ɁnakY.zakpi. SlUnr(yospl,oyoapa2CGth(-) (n=303)wwwwwwp+r59ooooojP/tr//Age(ys73ǁǁǁǁǁ7ǁǁǁǁǁY9߈Issplogy (%g____Z3ǁǁǁǁ46ǁǁǁǁǁNSLjOwwwwtYHAuncclV61ǁǁǁǁǐǁǁǁǁLjwwwwpLeftPricularjeraKׅWUǁǁǁǁ×߁ǁǁǁLj׈׈׈ׂwwwwImg/l'777721.05ׁׁׁׁׁ4ׁׁׁׁ<'A(pg/mW%2ρρρρψJ150ׁׁׁׁת=w//TroponTgςGGGF0.02߁߁߁߁݈߁߁߁ߐǐLj>EstimatedFRXl/min/1.73m20.ׁׁׁ׳#5.ׁׁׁ׈瀏Hemoglob(g/dw???? 2.7ׁׁׁי.3ׁׁׁׁיܭ__gn=󀀄"top">H-sensitivityRP (mg/l)

Datarexpressedsedianrercent;S =otificant/table>C-09Hh8g__Dailyasuremf-Reaceroteinn8althyolunteers'''$u>D..ylatt,.Àhatelier,..odges. Unrsalio1ors,owvilleustr`a, onclusH`H\jse!Y`mhO%rэr( fx`ekEl`izd, 8/ȷdispsti(8mo*P///.Tێs OȂ܌igYa'j)erlyy׊ tpAׂoȅ/ wRucÄihQinizۀNn@haps0 poassessf@ac'a>C-11gc__PYnXV`TP ST2ssTritur8EIAymKH.orl, J.֏(n. CliagnicS Di,A,p݀MB:80mmunoayonpavX2icroti°qfohib؂yffiXypcHJ9ffurdimpos[$}j\utoP(a,5GriPs,W0ocк W [;}@a`,ңityLISA9quanumte(s؍كh(XishPorhhowy9Xڅx\symp򀸂 '"hehil(cu9oronsyndr(ACS)ߺthodIanalys1zci)detlimihhΩX_instIm3pHl{ly0ormXampltXreX3)b0ntpann)r si@Ё,ؠHXfi@(15)l8ќwo (2)ep󀀄licatelateserunvHthree (3)onsecutiveays.ithinbandetweevariationasetermined.oRc:limitsxèYflank (LoB)?:singetalovaserum (FBS)sourceImatrixnownootytaableT2.sampl`wereeasurxsixt)(16)epskf (4gax`TfćDxQuantitQ1bothd:CLSIrotocolP5-A.Ƅ5diffntsmow,PrmЅc`rse؄؇us`assayW#ias.
C-12g`__ImIh@Rcarcynchronizrapyu>@E.ANCIU1,.ATASESC,.ORGULM3DOROBANT. InXtuxOncologyuchxst,_pnia,1Clinicmergyospi7_Unhrsity “Polha”g_ ©Background:eafailu(HF)ٟto( lexyndoc̞YneurohPon$cytokٚ, triHo霈hg.Üߜߜpy (CRTradjunreatm,d`YHFs,ommpJic,0(`( drug8eft1icP(LV)1odegXflڈastrucLfdeioԈjoccpHFрA\ccepgo`iIlHF RTqd LV.׍0invigi__,sserumPvelN-P -brna0xdNT-BNP),Yinflamory^s (IrleuxsL-1β,A628umnecrosfTNF-α؂rixeloHtese-2 (MMP-2)tissunhibi `(TI.Methods: 40?(21M/1917chemic) (III-IVYHA'llPHeRS, lRo:>val,gnif葐LVys5ir0akǂǂsalallo󀀄ostero-la8alalltrain >130secypeckle-ckingC-13xg`__H؅0se+arcroXؾdegnawo u>E.iyajima,.irosM.akashNi`YFujisawYonezjOkudPh. YokohamaØUnry͜a@Cer,pK,apan, C-14hg`__Evi`cÃPchum-B-tatriuretHpeptВcir1Y. ߃߃߃A.Ǘe8ov1xHyTeLtd.,urku,inlxǂǂƊǂǁDepart0PharmacologSchoolFunda)alediتMoscowt(n sitȀ,uFederOOOi OOOLBiochemistrOÅ/Backnd: NР()@hopnYoduc{myoumbvolu^afillsehcyst32miacidi(s (AAR)ctP݅alo谚-tpiragX&(76,omcursmolXl e108lteolycleavagpBy)apknowhoipfuliomarkPeailH (HF)Brisks0m繭o(,Kakxpla0notiselytifiedecahXthatndpreq`substi@0nhjyqimmunaÿ́1HFtihlthyoWeaPsuggp3c؇)ʆc,0 ' gof쇒tudyasYexљ0hhyps.OMethods:sllow@yProYcell-bexpsseffXencyɏom@؜jO-glycosy|threon71[cloہQÃTЉ(C9h:!findh`worm‡`ombK,8nσ(XE.li;|HEK 293se)x2(injecintrnousa(n=4ach𫋡X[73JapyzgsaȈ(ЄIpspȐ8pf Iraygepil0mrme (MS)echniquesere󀀄ppliedoharacterizeroBNP9cessing.

C-15g`__ValiBDapiderumub0ySTATropon`XԁYRoc0Co411u>C.ˁ,.ockenfusrSaengerbJaffeHarQMayolinic,s,N, t/i8Qif72ir0w2g҇: 4321443 (97.5%)A lί&. 108 (24.40hadlevelŒ_\.ԑuχΣ_qaǒeiip00 (`-p49A0.140)Ɵ!WxhibiQؖ;,;hwHqsubspT;g&g250,Xxn0infncI8tym"tay.ӄX??'Bd%7ЦonlyXtwoGdeP2ha8neghxrinc؄b3-ddfٶR_WUЮschaX(/uW 󀀄Conclusion:STamplesieldnalyticallyhdlin|cordantTnTesultsithЂ_henestedPheoc0Cobas411.mongareis͂,rroneousgbemo(com.urataugg(at_canesfort:simayv`reduceJfrequencyf//(.

C-16gb__VitamineficiIneartailuWINormaljectraJWWWTu>F..ício1,.orge2M.ernes.DŽanzieri”؆E.Ԇ esquD.È(reir7. Diagnósos((ér,ioeano8razil,www1wwUniversidaFederFluHense,iteroiVRbr)MBackground:Lowxlsvhave藨revaleisctpo@prognonXe (HF){{d=f<.FnK(NE@nmo tpma8picularQffIHeRorbiditi؆relaship`twe8lǁYrkt@blished.istudassessdgoutpenӌ:diastolicysfunDD)כ0thods:Asp P,)79ǃ((age 70.7 ± 4yXfeX2%)(BR쁀 e -22°ӂhEF>50%. 30clifi49ى)trolXpllsubmit9meas(mH925(OH)DCG-typeatri(eptide(BNP)issueoprmagxqxOdy ryia]Europe@So(trCardiology/ҷ:PσhadXuЂhndicDD (ie). )hA‚,;iI0sign((34.33.0s 45.68mcg /, = 0.00447%"'_X (<Lgain24%Dotїׇobservɝ߅AE/E` (r -0.278= 13),ut*`NP,LVLAV-I=133D244;54176(51hH65Q1U319U13238GConclus8:Pad,*K׉umo8/.C׊׊nϰxnoninvasQmarkЃLVillxHre. `’Gς14.9±6.7

7.6±2.1C-17H;g__Exuationfroadrenomedullin (MR-proADM)sredictorearlyeathnLmyloidosi u>A.arassiݳ0u>,.usso,.ЀadinMilaFolׁׁׁׁ,ӅerցRccioMρVlziPEril??'?>. DepartmeMQineurgeryndĀistry,spedaleanolo,niversity,C-18P.avsak. McMaxrn`ryamilton,N,anada,ȈXr)MBackynd:Hr8cxicH퇈becompl mowex,fgll/ath(c]()ntrXmyoljur8uCalpaccepɖrset9orePadv[GAa (hs-b9ssue8llkemexpmajorYiuhaKsi o.urbوtudy pmuPT_ׂՀiЙwwl.ethods:\popul00124b))(n=60),var32coll=27{melanoma5)hSp00EDTAlasma)pYlXdiaOntoumoBanke -80CdEc(YhRoia4s(esߋ߁ʌH!omd\ClLabooSsne (CLSI28-A(Xjs菏ResultćIQ4g/Lu׍) 101emalx22le;ἰre: 35-90s;u= 62)Janon-GaussY(Kolmogo-Smirnov:<0.001"ononߣԾφoutlibyReed/DixXmb (OIfromOt95tha>C-19pgc__DribuGDF-15appntssУa-rcia򆱹ECLI)inc V.lemt1>,ԁempf߁߁2߁߁K.׺rǁ, J.ar chςXgdmbH,enzberg,enyX77e="󀀄2">2Medizinischeo8ul`annover,Wermany, zbr )Mackground:rowth-differentiationactor 15 (GDF-15)semberfHtransformingRß (TGF-ß)upfamily.ardiomyocytendhrellypAxpressDŽ nesponsoarioust)ors,cludapro-inflammapyytokinre(ivexygenpecies.ec 8`ha demXtedatidepe(risk`"pxsicvascularisease.nilƁjaQ-commercassaydevaluechnicance€mymarkxphealthdividualMethods:Hasureمp0narlyvelop*loJabn ECLIApiplTcurUlecsys®lat)swic(ttwoonoclona(boBu)Xpt؉*deserumr,.oolsams)cis ydlsetwe1100160Ppg/mLreliare9ً973ppaq'&;exǔhroPyifiֆX@z#񄈉Inairpop(Bw@pof 517e|456(qkgPgQfrom 1877QdiuryA2H()/td____[1stA(ys 61ǁǁǁǁǁ6ǁǁǁǁǁ73ǁǁǁǁǁ»؁ǁǁǁǁ">I'DJ5.6%߁߁߁߁ߚZ9.7߁߁߁߁ߖ0.3߁߁߁߁ߑ$.9߁߁߁߁ߋO17.8ׁׁׁׁ׋8.5ׁׁׁׁׁ58.ׁׁׁׅs21.0߁߁߁߁ߋ'-sensitivityRmg/0.4ׁׁׁׁ77ׁׁׁׁׁ8ׁׁׁׁ94ׁׁׁׁׁьPOOCystatinË????>1.3/ׁׁׁׁ9/ׁׁׁךC.3_ׁׁׁ׿./ׁׁׁטoo'''>Hemoglob0(g/d'????T3.ׁׁׁׁ1gׁׁׁׁԙׁׁׁׁׁ9_ρρρόp󀀄">Prevalencefedicalistorycardiacisease

Datarexpressedsanrerc/table>C-22Hh8g__EuatiofhelecsysroponinԞPghensitiveTATsanocCobHe601latformu>C.ahu>,.ongJMdipin. Alexandraospital ingapore_Xth3 - 8600DŽDŽDŽǀςς>DR????9971%/e0gy =P96x +@02 (n=98_r|2ww0_GGGG">89ׅ/:>î lhon???ElecsysnTs߅dfou0Xbw@Ȃrufactr’slaim@Cstudi howth`ڭrelweుoHMuH.ɂummary,degٶr(ssayu󀀄ration,hisewssayouldideiagnosofMIithasterurnarounpime.

C-23gb__DistribuI(clinical0rrelatecarHcroponinnFraminghamearttudysltrasensitiveu>E..oglianese1,.arson2V.amachra,McCab,.anuzzi.angׁׁׁׁ. Mchusettsener`Hospital,ostMA,?????#nrychoolAMedicineWRYbr)Mackg:ԖXggso=eyo ljuryMacuteȗўwell-establishedفbdvehhly-Rs,tinowecogn atircuombetece individualhoretl llouxef@////τcrigo s(0rac,alth(wnromlargepidemiologichort,“7)”.oMethods:1measur8QF(ErennaTnI,Ӄulex)3,450pX`panPttendaohexٱ:.lowlim+fo`A#H0.78g/mL.nrefecXampwabtaxdycluddzprevalɎoyى`xfail,`rfibrطDbhyperpsobe9,alvrleftriYrylHdysfun,ulm (abnorcexpio volum1cond)ȁn (GFR<60l/`)esA1,159ubjsHmprcpo (pP55, 60%omeHe73%Qs.n`ivaAgres;hx (p0.008)incr@(p=2)@oci(d;(cZ@Oco(r,GGãbloodsQ,omxex,moktuHlerohHDLo R*\Ar8quippro (T)uJBp 99 thߵ>ehÂr 7.325.2ё` (depх9 p144.2.ӐpمDžDžDžDžDžDžDžDž12ȅˤ7Cl:õ˦HWthree-(8r@iddle-0Xd.NzمX鉩T+a>C-24gc__CVHdۇqDiagnospccHcyAbbottRCHITECT &;-STATNPs///,u>M.̀kȒGGD1??0u>,.er,ʃKaczmk˂Sh̻H.Еce2FЂp. Hennep0CountyedRCer,iap@MN,gggggBi0ؔYng"ot,DfFdemᾘRteetB-typatripeptid) rugQH dとrtail (HForivPhstu᧸H-valid󀀄ationfheiagnosticccuracyAbbottRCHITECTndi-STATNPssaysnomparistoInvernessiositere. 994entsresHingroughBemergenroomtennepCountyedicalÁerruleutrchHFernrolled.asplasma (EDTA)@ctedr<’sevaluwbankt -80C.measurlo manufactrsuideliy(l9ee,.ńronxhealthecordsreviewfc@$isdemograph inHm.Ќ-wi]csifiNeworkAssoci(NYHcsts,ɀ!)AIV.Ԋnᐠ(Fa61s,1greahno(64y. 58y)02%subjȉ4male. 40ځhagHF.ędetho!fow ROCpsndpurv`@iv pec: 0.79 (95%Ii6,081),/77%;'66T8.75 72710.7728% 69%MnZconcr yeach3signntl@$ZQse؃@Vsymptomxnqtab
ResulءQáO8/td)@OOq,g/LN߁߁߁߁߁چIV'656ǁǁǁǁǁ114ρρρρρ36ρρρρρ760ρρρρρ829ϋ{ǁǁǁǁdž1ǁǁǁǁǃ4ρρρρρ677ρρρρρʍ7oo}K4Oǁǁǁǖ08ρρρρϋr2ρρρω35ρρρρϘ1s/>&"1C-2bh8g__DevelopmXa ImmunoHDi@®XL™grateXhemistryystemXthOCIxModulu>L..uggau>,.min,ffy,.ӽh,.auer. SinsealthcaDxnostics,ewark,E,1,.u2S.usuf߁߁3߁߁M.cQueen. McMastUnry,amilton,N,Óda,77777PvҞ0archntuteXdЄggggggibr)Mackground:Ȥ7cardiac(hs-cTn) mpbefustabl8et*knownKovascriP(CVD)ቸubs8hÝ schemic #maj ihaCehTjnotsgnooutsac xronasyndr0!’sima˄al-*׬difutureߊߊډRpeopp2ԋx.Me@ds: selin)rumpm8ePmXdyrqile=10g/L)2572ripa9fட.riefly@wn ≥55xsgasto1,ok@b0s,pherșəlhtPddTac (e.g.mok0,ytYA@roalbuup,tc.І failenrollПRece achar@@ (ROC)urqPys)mQ-bHd"primфYф (ampo0myoCfh_eath))plan-Mei`YCoxpohaz؆$/(nXllow-up 4.)xtconɉcoeffpvaroɀcourۋ!14.7 %a٫yf ({pool;=86)ɝp!optzo7drPo6.ubjec_XsɁCxgbu(FigxAfadjuہqi@rtXè Ӄꉻ.9 (95%CI:1.5-2.3)o0Xaa<Qp7nclu)IbeЃ"99_?0жce. a>C-31Ёgc__PHl-Topubsui;ѵ=(B-tatriЇipe \xCHaurPTmuZu>Hhafi,poMXchmp,Ȁdrzadeh>Ced-Sxi Ȅer,osngeCA,PNBacknd:WhoHbloo@la,EDTAJ(purple-top),cseЯyȘ*׋׋(BNP 0`ark(Iriw(unsp=@fyעEge'.ЇOinubes󀀄ithoerum0paratorsoreroneoontaminationintracellularrganhesfteronghage.owever,sefDTAubxj gelsuchsearl-top(PTT)ÂA,anYvidelelasmaample,lmostre.t胸beenhownhat''seffect(eQceBHsomnalytІdrugs(pecimens.hetudy!evaluatHDP`BNPeasure@tAu th`,e&d/+bbyri؀qAlandi)sÃPaurPPstPs.
preliiry2+ignifi ti0retwAgene@)ǃw<0?Cz3bo`decCtabilitf:.Ӆa)ll /Hskxucђpv؎p(p<0.05;.rhr24hrĆA׆ s.runʏg04z~ڄу`, 0tively)Æ@lus…uipqi, automher.(sowGGE /g%T),9lᐚ.

C-32 @g`__NATRIURETICEPTIDESRESSOCIATEDITHӀqLEPRIVATIONNDUBCLINICATHEROSCL1ISu>Hxur1,.Н,.PackHhΟxatta߁3Tannahill4B..roaρ,˖P.eansAberdiRoyHInfirm,,niKdohGgHClin eachac,ǁ@sGGGGGBGG竚 Popul"ealthMBPground:natriticeptidhav 9Rbe8depe(p`icتfiovascriskasympividuals,vwiҷ$welllcurrcut-offss!dnos`@heartail,JadjusZsjfaHocibetwlprivۃAggnZreco`ЄÀtequexplain0by/ςυ/)ȎbuZ(oPnomgradiъ`??h()RviousPstud$imthworkxdqmWǾL5АIubc=aroscl1iBy0lpdiffecLJsk.wMethods:-typ''e (BNP) N-pro (NTP-wamplh(n=490)romPsycholog,ӈIBintI` (pSoBid)yqa㉸s-secpba whiparticip󀀄antsereelectednheasisfrea-leveleprivation.ԁ(studyopulon:pproximatelyqualumbermalesndeb,'"frombtwoxtremsoci@n:inachgertile35-64ears.astingloodamppard#roze@t -80°Cith oneourvenepuncture.NPaseasSi nsDVIAenta؃NTh-?mmulite 2500.ltrasouxassess(tɉ)carotirpi(forlaqueresenceROHy@t-mediaHickn (cIMT) per`a'cusao512canner.
C-33(g`__Autophagycymacrepcytokc1on???J.ao,.im. Uh@MiXsota,[apolMN, (GFP sol)RusyoeneristabXRAW264.7((nai@<0>9ҁׁׁׁׁׁ5ρρρρρȈǁǁPp[ly.DioCoat™XgelaI^ss`kit (sscesmhòEnqunumb!urPe\chaxerhc8څ_DlosiȘbmembra`.diumhAƒ)a` 10%BS"hemخtpft248sXrh},$ywbottom hѦ1%oluiP@lue;Ѵcolecomiʄ!`76)dpW`nelR&Dystem ǝÑimшClipopoahrride (LPS)t 100󀀄Mor 2.ellultureediumasollectedndapplitoheestanelmbrPre-coawithtibodygainanrrayfytokinesnucs.Ԃsignalromrhorseradisheroxisome0njugsedar݆japdyilmqu!f.
ULK1.bout 40% occurى*nockdow_Zange (p <0.05).υo(r,aeȀAtg13J5 |dingᄘv8aestentp%J@3c@sLPStimula ,xproNfan`nclumoXythem(t@ttein-1 (MCP-1),(cropha@inflammato\HIP;IP1α,CX2)ptro7777 -ț0dreEPsM,ghichree0saww)eo7tlyd!hc yoXCoa:1lexlayritlolɌ?unaclevXksЇerveВaltutȖ/ peight="10pt"(dth="a>C-34(g`__H-sens@z(4) rdiacon8Ts0versuswouidelacceptab81)Iۇɦ9cus detЋearAMIхtmergencyoomu>e.ernez,.hrPez-gago,.osarciaz-leivj2ñkonso. HospitXCabueGijQSpX, Resultp٣?()Mdif@ЅW eFc 711776 = 22.4 %WP29.3~6gd1.1g57L75 %sh[e`b!Ȃ(pc0001PcXweقik bʁI3snott螨l@signifhnto:sxed,kCidf1mo(nadd0l 50%)'v!e0??rgu@cceptaߵc@Ȋ. also@Xemiclevatio󀀄nsfroponinurthertudiesreeededolucidatehempactusingnebheseethodtmergencyoom.

C-35gb__AQT90lexԆ5TorwithodularT 4R..orizziǃǃ10u>,.alent 2Vura.ardinׁׁ,.carsell. -ii'ׁi>Labo0onicoVR,Öna,taly,LL`Raveno rbr)Mackground:ԛmeasuremi@(TnTs)surrlyePX forbiochemicaliagnosXmyohl㋐njury.newhchitecPRmanyealanagOrganizsquirXavailabilityPoint-HCIdevicRho{!o`napidlytliablXuIson(t)jzerstЀmaH8 aimyaPѣR*ercPOCT%cwTדדУ铧ϑ4)ǥssay5)._M:ו>(80becutivela(amplЕxedyLRRTJanuary 2011䊟(RadioH`Med,ps,enmark);y4Y (UE170NP,!nHmey).QDPPultccogLSIP9A3ȃX(boftwstsro (,aynUSA )edc(ariekerkBelgiumP!Xz,rI_>҅C:,OJyielpyfoL:westalue: 10g/L,M3Z;(f 140n25 13;1n: 74.55, 71.57B83.8;ۢ)2`95.4781.9888.pi0.c߁a2.ßBis aP -B@okgsyh:= 1.0 +H:Q;(l{coeffici= : 0.959 (95%ifide9Xer؀244-8786 L5.1026H0.4872R;s.994ǒyǂǂdžoǂǃ09YFigshowDNs <HT(Adifferom200-e(B>nclye]os5.C-36@g_[Label-Free8t鍰CЦsHu(erum-(Gu(d-heAon2BinsorOOOLu>W.imOOL1GG0u>a,.hρρρρρAǁǁǁǁ,ʃongׁׁׁׁ.0rkׁׁׁׁׁSׁ2ׁׅsׁׁׁׁׁGuׁׅwׁ>. Elroniceommuzs earchnstitutDaejeon,orea, public@,Seoul΃UnrsityuشHospitaleongnam, 󀀄Korea,epublicf,

1׆porgΎorrhumPserumampl@b)z~.2.͒\haveabr)Ygg(ilBF)plastbdano-imprX񕓓 l#+C/*f @igh҆Hindex@wdsiكT1er-s8pystructuȆPECVD?!ordmde.ԎJSib3b>N4layYt(xyэmamhydrloup (OH)—>conjugWwY/''b>suj>,/(̈pȈself-emblnos (SAMs:؂,.aldesex`FH0ip*171specif Е__[فᗀǹYkɓxain`P 3.esultm` [rel0shiftpeakHveleng膇 i'$ɀZ308 Ucon D-peurvrangfrom 0.0510g/mL:1&3*.7 g/{ btainxs7wqӤ9܇75ƃ#limiPp(LOD) 2oOe8o*,YC35k,郐0cXapply)AMIen boundary?9ealthyoa0QO3.6927Gצ?7coef0*8A(CV9d80Hv5S!below 20% 4.ÈhlXǞŏLat i>1993,342, 155(2)ong,.;im,.-H`HuhHSuG.قOPTICSXPRESSa07158972-(83urtisq"TietzextbClcChembolecularĒtics4|th>dxElsSa,6.C-37Ȃg`__Hӎȶ0C,troT}mhsJpipHsh-@eԂoutcom(r(cy(parta isucutronsyndea8 u>K.eljkovicMcMasterniversity,amilton,N,an,

oHsult)oxntopweРᆰosxp (man25wwtth>-7> ile]: 39 (8)g/L4 (<3-11$42140 536h;oxp0.001nognaiff ׋Ԏ?=t- f(p=0.񐸋ݥV87lagggxwsa hnd*r(AUC)695%CI:0.64-8]Wi%5pplied,҂0.50 (%37 63)At߂S`Arqor004) (Fig'>Ël0on:liq5׃؁`larlyDZǪOsetbW(g.@qmeasHsxbeesB!٬Pٞn. WednesdAM,u27@؂b>P@S  10:00m - 12:30mha8 Autoon/CHuA)cv?߂G>C-39g_^WorkflowTuroԠmprovC 0aȂolu(Heologyetyu>Sox7741//0u>.upp,.isemoreĦr2>ЁSarisalSy(m,lsa,K,ɃAbHty@açCA霞Nu>BackgҌllesagbo@o( ((@payw(yeai!dtaffSsöcpfovid:Avitumbȁerroppuni Responmpl⮈KHfer,픸xns @lyz,蛹v ᡆnewroacЌaHuOhilosophy.mBddXYb\x-EfP (HEH)OMN2010҂EHgBCELL-DYN™8pre,im̈PathfrIMSjmiddlewaXductToge}1de)heuPqu3theedicalechnologistshilemprovingheverallorkflowndaboratoryurnaroutimes.
MethodsnrderonHstieffectivenessfEH,etadtudyrotocoasvelopthat@uldseeanes,*pRexЇaHricsobj3lyasureerformance.rioylementationhisenchmarkexerciyLyoocuهpre-inhllZߊ܅uɆIrequirs.ɄOiintegHp1systemccurrPinΏ@mb2010aft)newc!familiapiwu`“post-”sɎp actAbbott’s?m㏒bXvaluatedResultT phahraNhemypartڈ́Hap`xi(1,200BCa ithqi8rif 179c.urineol350b퍙AhHoutsid@0nyl@P-moXiciqؖԅ`814؋,YѝKopportunity8errors_Cosx)po#vauscroeconomichenges,arPЪbpucir@ryXhgheanʍreBgt  m3$ar@uc(۹A󒺂ػHlfuno؊Ɂ ,ftegѾcortc8helpVϤ܎YucnZ.

C-40 @g`__I͔isiErprixQIXtrolromB׸aANetworkUSigmats(:pndardizeestg`Cule؅υυυu>J..ones,ĬHartbY`R.owakKrempke,ˁp8M.opatkabWilkerson,ł0u,.ar@GerȂSڃanvix,A, 2 /i, 32W3s</font>, 41s<).̀hlyataassedromheISoioRadnityndxternaleerCetlieervers.Ѐcomparisontatistics (e.g.iasc:means)ere9calculateX*gmaTot@owablerrorxtakenCLIArAProficcye(ngimithRepres؄v$o 4sithwolevelbdcrosȂperpe:

TH1>H2>RR34567Alkho">8.9ρρρρρ12.8ׁׁׁׁׁ9. ρρρρσ1.ׁׁׁׁׁ0.ׁׁׁׁ">6oρρρυnׁׁׁׁׁ7ρρρρ͇/ρϨ߃7777Ȇρׁׁׁׁ5.ׁׁׁׁ">2ׁׁׁׁׁ6ׁׁׁׁׅvׁׁׁׁח 0ρρρρυj0ׁׁׁׁׅl7.ȁׁׁׁׁוBGlucose3.ρρρρϝ9ρρρρρ̙ρρρϏ,ρρρϝ4Wρρρρʙρρρϯ'ρρρρψρρρρ4ߒW7770ρρρόρρρρρρρρρϛ7ׁׁׁׁ5?ρρρϵׁρρρρϖ2ρρρρϓC'ρρρχ$|Potassium:ρρρρ>13ׁׁׁ׼^ׁׁׁׁ׶ׁׁheight="0pt"idthc>6.4

cludh anethodfC@izatxyxxa0alyp diffntiat)perforG8romԎLFurXr,ndividuWcPhav o؍߈)n.icPh;thusAselectiveasȋAgarequi؁s!erroretAon."O1WTC-4ؓg_YAnŕ󃀒iAutomdUparyap,ry(OrganismHnSysmexF1000iooolu>X.eh,Ā`.er,.maM.ong. KhoockІospi,Ӎap_XCoefYVxCnB 16UɌyIQCe 19.6*.82NhighV,ߎضBfallitfHurer’smভfs4B0%߇nP:ͨoaCele8`remaiPygolht ar$I.owr,roc=bi#showr&kǮOH)assurrohcS8|WwyAstii`6fur8luciӹ͂ǥ9bdjunct fir@݃ltwo.

1MCerv///">3//0u>. Dartmouth-Hitchcockͫ `CLebanon,HggfPggNSchoāIntuHeal)cCPr ic`0OOL7?9712݀N`kground:assocbetwНvrblaȃLciovascularDasAms@encpdpet`mx hknowoo貲 Yun enlop8AtA[`nodls8o@pubPzissHecaׂwou@erw2seekuH/8diZ,x8Aiospiȁunre`xcxaopportӁٴhriskngeduxo@dneindmīǫrofile (DMP)imp0ϖϖϖʬ`2005.clud:a0AgoshemoglobA1c (Hb8)Baipi(ToCW,Ȯxensityipoproteinholesterol,riglyceridesndalculatedowensityip&c').nffortoonstraAostpreventnnecessaraboratoXthingwotegiweremployed.heirwaspincorp1ionfquaonnai@pa؁DMPcreenqpa0hatmit]onlhose(tiithyfol(:knownamihisHdiabeellituaex ignosisqcardiovas1rseasegererrquala45yobea[seHdyhvolv(iemGernHCommLangu(CCL)gram (LIS:gf,ansCx,o.)1q(rd8r`er0rdivid9 compon^ rious 12onths.Ѐresulك{0ebA1cXianelPnc .
R apiѸ҈{.


1,.lackwood,.ø`ke2>. CLSIaynPA,gggggJohnhopki@UnrI ,altimor`MD`i͘B0g0nd:neIi@ypesystem0sLclXoybXufactetYaYocuQ+ouworldﳠaiXbaddXÁXhe ,chhneari0آci,ruZ,xrryo,riftarab,Xf9inter,li`Adetioftwqbvab ˆthorK7qOifficЀe-umta>iaHhФoihep|Fs%e`hlalignQSgup0DeXA2`lH)accX require3鍸i 󃉆idw__y(iafibLpthodwo7זbSiHib\ςc`…g(1) rցψP3)P%zT<;p0vPG_S E (EP15-A2 )yauracy͆n(139򚿑@a鄡(2rLd QuaveaYJ`l:Ӂ)achoo06-A8acrorang>esI{exa8ehowɀHOoŁR(ggBufhLC-MS/MSologXtʳnsniversitylinicaleferenceaboratorynaltimore,aryland.hetudyesignndataputieldsimpleeasyosenabgeporteneiok-offfficientorganizedsmonstbhise.
C-44 g_[Autom:analysXoflohcelPcpbrospi lАropsu>P..ott,..arlipp,Ā.ompeo. ʙ„CamYsVSP,razil, PDBackground:ouely, term0҂@tIpermmiccopicxa-.v`sqcytologꋷOsManuxchamb!rwhiteߍ(WBC)leukodifti@acrifugsta(depa#xaime-cug1cedu`ch*lsxubject@neiinПڜjabil)owcioFcw܂ȁH4aZЗVglobکЈoǏsrsmH{c^͏:׭ied, 216(11274PcitЀ30P).u:Aup12ourHf`llndard򘃩WdHeryth2(Rݓ @td(ߒir-drh0nzMay-GrunwaldtSSysmexE-5XPPS@Jt-`l!arres (ltquc)[hRߞorreȁbetweeth=sultuzh Pw,c Ҙ(r>0.901aasrjLtgAa8C__ observmononucKr=0.86;polimorph//88@De`{xJnshowpgnifАu-xqag@obpᒷ0<391),MNZoid̀un ׈''#(p0.001)9Ь:p,ް(Pk0wow0tH)prtrigX .ƉЩoooy2֮cT,Xӎ؉WVhpoth ыpreporq naXӈz(ician.°Л moXp(c m,𑨄c@fulview 𗠫oryy֡WWU΁(largstudi0maycessdeterxnefPnWK/CSFBCounts.

C-45gb__Laboratoryfficien shensingheoc0cobas 701ostnalyticalnitu>N.arcus1,.ayton2>. Hvilleospital,Ȁ,L, Diagnics,ndianapoliqN,br)MIntroduction:Ԃ0Automated8receivePprocessYlyzSdHanveragef 4750hemistryeolog`CoagulaхmmunInfeusseas1C;Elrophqislooamplperay. ur,tsntitoXliabsystemцrpecimens醸qpdfrig@IenvironHt.σp0-EsoluuHalsoP!0for@xtsumzasklocЀretrievy150+ilquestsorddiYpr@pdraw.evalu7/st-alone2ipgdxunjalitC݈rovidob ,2B`man(g姷蚭bjstudyoks9̈́'gain uɗ|set1extZP esaʄ70regar:w׈ -PV,owe,eiscohshoprXnefa?:ߊethodcompaсamoHifromolordptQ_IC-46pg`__AIMPLE,RACTICALNDpOFITABLEOOLORALIDATIONFEWPALYSERSNhCCREDITEDABORATORYWWWTu>F.ernabeundreu1,Ûpabero-GarciaWWWWV,.œban-Susaet/ll>1,.rotons-Rodriguez<C-47g`__As@sj@TurrouTi(TAT)ɞȠ2"lzRodularre-AI(MPA)НӠ߄߄߄u>R.babez,.auC؃,ӝpedotal,.ʗ`gah. Mayoæic, MN, C-48g`__ve)sisPhPqDigit`Res݁BIfix4phxǵ@PPernsS.haX,ˀXweat,.lapYG.ЄkRRhX,ʔru8hA.orn(st. Un rsityArkanspMedbScien8,ittPXAR/ixDBackg:xa8dȉpⓨ crea10 opE_yežГ@m弰uHPimencZHsuchchnJeKn amu0serum̑a(IFE),gcoul'lutiliz}qgSebiarernewsPnќELSCAN dcliЄ (@ertakenthod``@udy,PcDnumb(pobteb@Hdqfiӊ0kcoron"׌ٮ^.ifthreewсPS HYDRASYSKipr@omsmyel؈*say|Urevieipe(rfex𠪄4diPgen)vis‚diffP@m-A)ӠpEpPIV700(oPS)IP=softw(v.6.1.2) (dgZ8B'!4ăon 7.4.5E)C??>ҨqbitmapMicroictuZr (designateditmap).llbservdistinctndn~bs (notimi toonoclonalroteinK)onherigiAgel

C-49 g`__EPctJmodXrPselЍih rPrandefro\0s(:rI u1onu>L..cCloskey1,D.̏8A//,2//FPkle/. Je顙UnrsHospYP8adelphiapA,oooooNebraskaeIlÑHOmahPNEPYNBackgro` :Ғ(0)ta*P10,000)҂i> (U=20-100)G¾{ٗ2/> (mean=0x=1)pіwXAuh/ seudo-dnumb@generaccordYrob{LߌR{seeigurpA0olCalgorhm,ȈA6unGǃ (circlesshowxp(X@ponposϠޛlhi-squ؎pnsunctionf n (lines).nomparison,orampgestrictedoheentral 95%ynormdiabuR(squa,ashs,Wonss(app)swerehifdownwardyothan 10%.Ɔ all΃50therileR׃р%dwless{25ǂǂǂunwvmportantly1is`dHxtdata^not0recognizabaspec71evaluaHoffmplInalyses. Conclus:̈́popula selPQbiȈPHri1egm#ly8cdramcjreducɆpshddeviasuch.ӀYmayoh…!Us (<100).
C-50g_[PerEˊ^Newss(Zβ-hemayystemhχχχP.atta,IJii!i>SiexsalthcpiagnosxHTarryt,YMptrorPbjave: 0{?߉߉(B2M) mo rq11,800occur@nuclecellonDHLAlextsxn(sin|blooyܯ tiY`freefilځkidneywhiZreabsorb8 degradtu` Tserumve fou聠SyXdividua qma@low.iseH[4k`ulaerՄduocaityEimmun,3hinfrheurIɁ8)ath;pǰ iminiʢ`4CdHge?^Ycoulhus8X0rkء!(m8i4capacif8[v8ecXism Xout.ŁQ׌jۓʁopPwimimye0chronlympQeukXIit$gprolife,sifirYxencdeng-to-c(niQna *a1utz` -ze@(Hpp!3o]3Hstudy!o;pvW|s (eHgggeUS>̈́ rii9Methods:鄪0˅PdiluI ca2aufXatts샘xrȋBbodq:y-Ige r턪ґ-urbidh,ex!whip0mXuX545mш\froHXarurd`t0ankjPle-- ib orӑ{)luprxsne,arڝRorZ;datacol8a1200, 1651C24$80o uqM֦kGm`c("`C?m8twe0:N̔β2-Micro@LBN™Iғ:jimF(%CV)=qthp'' po(rangѓj~0.6 ~16g/L; = 80ȕ0///y)≤3.5% ()in-run)b4total)e!!lycʟ89tۍh 0.2518ڂ 5ҍǍč:1.(BNII) -(350.9963;2: 0.65-16.0g/L).heewethodlsohowedonterferencet2Mevelf1.2Jithnconjugatorwbilirubin (upo 6dL),emoglo 100lipids (Intraj,reseniusabiB;ׁandheumatoidact$25PIU/m5exhibiaaximumYdaysYon-systemtlityZinc@brationrequy212.

C-51Ђg`__Aew,ȅTAFerritin,valuKJii. Siesalthcareiagnostics,arrytow`NY/i$ooducyObjepve:ns0Jmolecular-w (~240Da)rotepthfsprimairIageXmpoueody.ts4ubunitsYapheriiembl`xyx8n coreBtwoAm:acidicȁbasLift؛jmsielfamiiso؊ehph0immunog8cب@aeh9nillhnell؋sedoaPόq(֌LAoccuril`r,lee`bl.easur15؎d(dise(Png@abolism`uchc8Qideficiana.obhveosefulrkȟipiH`rapHHHly١wrunCanalyzerslowmo1.&*B{autclؗ1cIeetneehvolume슨Xoox놀XAocHstud˃e#v} (HUS)̈́ riPMTlXx-enhAturbX0s.eR1ntaybu2c0arlЍkXiiygȐ 8򝳄sig@0o@ggluPduos^lъp5,ӳowmitdety6S(a)dheTUeigh-throughputGGG/ *nderhopt.oHvailabsale.


Automated,n-boardreparationfholeloodamplesorbA1c GGGDu>G..lackwell,.ilson,Kasali,.ee,ԁs. Abbottaboories,rvingPX,Xirx)Mckground:Accordohenternaliabeede\(IDF),jnumbersp@onsorldeth mpitussxpec``lopfrom 285iH8in 2010!438308ssturbasset0sticayanvenoreressfactthat2*ulli0individualodaunawA yavR1ease.isuch alarmђdicyLehaccu@epdel6HgnoshnracutTQenpglycemicontrolrkЕ1c8000ϒϒͫRRBCftwoouut؊%CVr0.42%/0ɱ .ol50&ighermanceHdh(otography (golt irefy3)ang22.12@88.37,ielYlx39916:Rp2p> 61j犏 42WWWWWWP5R$ύ2snclon/Ɯ!ex9iυ1c ߕ>;v B%@tu 1Fbwhwamh=Sgg,roduȉF±HTotAllowa ErrquabyheAPTurvey.hisslsoonsistentithhearmenicos’iologicalariabilityoforbnd8A1cC-54C.hawX>1`/u>,.ass2R.hrson 3E.iebo߁. CersrDiseÁProlrPrPn,tlanta,A,9Associat71sults,ցpe,Ãggg`ggUniv1ofrydX,,altimore,Di)Batte؂̊Publice hearchEvalu,elWbr)M8ckground:hiHesx@tebmrincipleareimi)?8appGl׃^quaimprovet`e 2006,הn (CDC)aspdePracti(LMBP)nitP hii芨`newymcvimethodsoshunIeffees clI77pre-2post-ay).urbjHd3eb܏5`ahouldHcrZknowledgW(EBLM)sqog inuBE)㍨it(s).7M:hH 'A-6'ggdhabe`8byrmi-disin ymexperanelxWorZp,(scribixta`echrepoH2010 (www.futurex=.org@An piloomtЖ*manywǐǁhoemumYksdarXgoodudyignhkmacceptabylusn3 pecifquirshteg -v?(1)SK:98؅(answȄquȍ(2XQUIRE:Їao13PPRAISpHВpraisPda(4PNALYZIynisligi(5LY:isse#find@s;(6)ASSESS:asuɐiargeoutcomesRaim faci)dopŌ'".WB*Tuyɱro@HoC)f"vukutomА Pss+[m76E)oǛcurriculxP1l.eedbroydžÃhealthiors’xnhor gesH`IӦ+AuguiȎtɲpeYDjcDoPzꖢ@E.opt"`tiς`ښٮXK1Rfiecology,nt:kiasʄe(sybovis(ly[s`Ջ,Hag (fȡ,8buil0u8softw(h貛tngÙ ,[Zcsz;_Obyڠ90knowXgnhazYl)s8sth ghvey@(;jnumb؂ sceivICExillY@n.ÖsVM(1vكutp$e`lidatedtepsoreviewingndvaluatylaboratoryedicineualitymprovementractices.ourseontтModule 2ccseylڄ ctheigof__ssess
C-55Ppg`__LowerumantervنQhamSinlinicchemi yceologyordassuret0فduu>G..uimarães,ʀá,͐hilloCunha(i>FleuGroup,oauQBrazil,PiBackgnd:owadays,ptimizihacost-ulatallengenvergrelat׉sha a q9soluZuaOupImak+workfllean9mo@.Ȑ(,velopy"exsedecinsequxly,Tdepen 0sbabi|.Hhs-؋`eᆠlisorrtubeHngPPeYlify/HCm!09-v.τXPo((aw-spzffnonasaskpHl`ealth1,focr0tiRjobIeob@nl`utYe8 lac>unewsrobo8{inТ1)/"xd钉apXamtXim:ũmethod$up´(ǦϦϦϙ,voiږ xtȁndardizs>":uoyea ata+b`HcfromA88,000/0U(ɔQ: 45.6%HBloodÖs (CBC), 31.1%1cȷglob(0ErythySAKR9(ESRX11.3HBC +i, 7a2;3.9򌭗ऩobVTSDiProqtwoysmHST402zaa֦™M96ystemrQ f`IO-RAD֬ aIIpAlifaxest1ʅȃ,refrigeȌ&Hgoom.蘰a𤦟aly) VsuppК8gthm;x8xtechۄFknowledgeb(Ȩ[8(coeҀ:՗cribңïinvɘ&wxram)w 80%, lay8I0.06%.ecaP 79.27%uz71iL"betwb:draw3nwas 3h` 14minuzutpɜ\r#u(20.73%)ʅ߅؅uJۑWx\physո0uraH.Ĥcorre(fvrx3xmicroscopZ׿])8addo8l9imseپancoul(lso9BieҘpur>0nclon:ҶWHdeXh-vxȳ i2ve`yfast,ff af numb0xLIrtM噜q0qJimvyӣdоlhmoپocro@.



S.adan,.al,.heldon. Pathworkiagnostics,nc.,edwoodity,A, C-57g`__Pmve9aAfSnaly(a8 u>S.arsh1,.rtez,.І߁߁2߁߁A.ӌh߁߁3߁>. OverlookospitalummipNJ,ׂׂ׆YׁׂMorrown͜țlp777377777779gkalPignificantly benefitedromutomation.ithanualesting,heaboratoryasacwqchallengesfint tandardefficiency,onsistindmpez.redic Ahorta alsonfluhoureciso}e.ԁ@mproveervicesstOphysan@sq,reaseurn-around-time,ed(ǃamenals+MElectronicsQA-V ™ӁAzer.ՃxxLEANrinciplЃPntifimsstmlinhileovidcdlaccue|tesultsЅ+ 0hop(Haapidlyterm08totspXunt,otilitmorphologyɊpcXnP3techn+bn劣-opt"sigH sinjunˆ3algorH8built(xasoftwar pcommodf@h,-v`czbash!F
a>C-58gc__coK.il keττ10u>,.eld,.ramer-Burru,.cWhPer2>. }iiwׁi>MidÒF,ndapoliqN,1RocDiagnXicsϛ`Bc.wwzObj:oewʩr;woulenefitk a(d@rkQ ( ??=)pla hseB!9Pstrus (2-OlymppAU2700™߉ߑ 64COBASXtegraggdQ_^).op؊r*Lwoc 701combd th2502TusutilmadɾH cepeypmd8samp!load>tudyes:0vidZmas: 1.).1rro.gي`uPr:D,AdPlopYappriisi)pPtocold(1logh2DǀPo, 3///-simhϚϚϣs4ssPracabtyrf׃ oom%qu8naico@l芁,wҾTurn-And-Time (TAT):مsudihaxbwTable 1.singhisonsolidatedorkstationesulin 5%ducofamplesueonneedhaliquotsndecreasTAT.ptimiz{a(cco@ishbysingptailoradeagentIcept.nD,Ȅs-On-TimezSnearly 3oursver24eriod"intena,fhl,㇈brqutytrol,ʼn$techniЃAsol.henmpapinstituoHnerumHTtheb8000odulanalyzsx`pracabi2higher.
T1[/td)`>Run #xłhaAhcs>т______>RTG߉߉߂1oPeak, 2, 927@bA1cven0WWWWWQ36mρρρρρ53ωOO|2oOJd, 146V40ρρρϏ{h:0ǂǀawǁǁǁLjϫ,da N1064W<c701/*c502>j7ρρρωƒǂǀ^bwǁǁǁljljljlj3lj 18߁牿牿Ղov0th 1246nsolidateliquots (duounningrom 8epte$analyzh)WWWWW 4ρρρϋfd/2 a)1WC-59g__ReducturnandaHstreamliaedicspec(nrocessworkstationhYIRISB.҂orga. iii>MȐy(ary'sospital,hHl8er,IWWV WW??=/̀MlǕ(pMɟIXԡtwoyw___wwwwrInteȄal)anmvxh plahem˝QimmunoassayesTAT)erformin0laboowhHcom@(ditional 10minentrifugationimes.wotatSpExpress 4oeseplacedhreeppendorfGel᐀LithiumeparloodÅsTbytarxhlebotomchnique.otaXtroponITATsultmtoX60)bepeafterlQ|iysċ犏߈֘aǁǁǁǁ pntellig)LabystemloaanuyYs0ЉEveia͜xiIS󂲇`m(a,fx8sreceiv, 15Yׄjcpuag; 7.1qlongᢐGoHTpdataa0ighkewd9ibu,o直raramecnoxermedtabsummzi:nB҂>Aςςτׂ?Džb>///////////////NJNJǀ߂߂߂Me[SD] ()?ggge319]248߀~3~8OOOJdiX7߂OOOO9ǁǁǁǁǁ2ǁNJnǁǁǁDŽ:6NJwwww75th %ti8ׄ߂oooo5ǁǁǁǁdž7ǁNJ׀=ǁǁǁǁ0NJׁwwww90׊ׄ߂oooo">4ǁǁǁdž4ǁNJ׀="0pt">43

39/trrwwwwqNthJ..esenberg,Pck. Altaealthervi,Ґ(Deer,Banada,XiNBnew (`)teghchemistystemromބccDiagnospsshotomeurbidЀgener6j,don-semi0stechnology (IMT)Rrochx-bas`heXooummunoays (HMiule hhP ityomсɅzluxes!WRLOCIeiqhtYnГ1zolid#)>flow.WstudyӁ@b28TprioϥO.ƊAachᆑ,includnȍٯbЀ/wpveXjfow{1,Xclaimszt؟earX/reange within-runcikCLSIP10 (Preliha/Qu0iC]L_Measur{P1dps)to8asyssbiaȄvpPryXdtpwoevelsBio-RadHyؕ؋sexK텸m20M(me@SD)compoRp笨paQi?rse0`V0a150ȀrPcorXуYs'x- 40phRْ[JӸpws b#hdZ=x:笈1(硋0ponI7img@cindex0093"lign=" Q"F515F577@/WwwpOall/(8tb qfacAכהbobetweeWWQaccepisגגԒdnlC笊0Wfirm \zAGGGGGT8ψψagre+.1C-618_[/Ydigl0agingr8끉serxefixg@???L..exr,..otte耉illiPGedoriwBA.ainsth,.҂xcCuddeUnHryNAaPhapelȂ,C, ]Nu>BackpObjec!8u>:8bgdopineveralreasfathology.dvantagedigitalmincludeinkingesultsoharPforonvenientccessndfdmotehterpretation.heurposethistudy0ompradiserumrinlectrophoЁimmunofix (IFX)QscanssaewelSystem (Sebia,SA). MePds:ivexperhceders,hoebdt(datayz200secutly-@dFXesrunnӄq’sYDRASYSithH2/4garHydrxl.Ʉ eview9 sampl2ffwel` hysic s.ā'8aow-HolȋLR)3 (816 600)ighohHo13x 1P0LR]ꆬK&softw(v06.5.0)HMicfficeictu0Mger1ichlhzoomrd>manipulWtqH+leisc0٘emrs(uldot si,utli@sible̎Ŏ?rus3goHst(ardRSBaa@ԁρ,XalabnormalȒad ifip50.5%sens vityd c /)KY_q82.0% ±.6 (mep95%yfᄠbpeccI70.1% (16.7 ?0.47.4iAa灸P926.8ӌX14.thaXmajor܀o9bo1^_#Ose, 4isaɏiouxistorm`iyeloma.ˁ)rec(20onthf7ܯion8urlyAIlQi0Ӛ??nWQchaapyґtinuofreghnp2.҇ޟm(10eal2been`szfoQp҈ga8)ubsequsnoׯChPhmeClÊ!haI|wmbyOn').ȫࢋ㒝lǣ_7limit8csigna)wNc`mX܁si8benefioɻl}abipyk[3f,og+Rg.A(suppo@iy+GI*xoo@prahce.

WednesdayM,ux27@a8؂b>PSe: `:00m - 12:3mha8 C%SH/OutHe<>C-63gg_^EarSeHd-Tri0{rumiRNArox Predictǁ( Diabselu/σσC.hao<>1/a(xongׁׁ2ׁׁT.ia߁߁މ߁.hiρρρρФu߁߇O߁Rىρ4ρρȬS.an烯jHunjShaρυρβ8Dep𣁣YLaboPoryhHFirAf9a1HospNanj遚Uni(s(;N-Keyy*nqChina,,'''''Epmiolog0Bi(sPs,choopublicalth~'niversity,anjing,hina, 3C-60bg`__MonoclIgArotei Migoβg|Ŧropho@G!C EIQzUs9κڀQ8vsHoooiL.rba@1

SdP'. By8SiGrouptd.,IRMINGHAM,ndˁHdom؃DrHImmuynfH,ԄM1School1qBirmPhaP7769eAccueDIPmϵh2(M-\e(SPE)#di!peH)wh heyP-me oկ`P8dYbodie!ɵIwhichco༰junepit ioglobuP;(iravpartn!(/n;LC)(wescri؂0@ayrt@detӁ"s(>򨃦/+c re81th8mKd1210R(145o 6k) ipleymaM)t"s`escomP8viouspublish/refranges,sicPE fix3data.x i8Ppp,tespik)rac0d,𛀁0norum@aknown(,__.C-65gb__EvaluP@oxXArylesAQWOxidStatus)ChildSickCellnemiau>O..zturk1,.ilmaz,˜.ՙaśnc2V8rica߁߁߁߁χ.urtgo,..urpınarڄondenӣogut߁߁3߁߁GXktay߁߁4߁ߍ[ArslaH. MustafaeUn(rhy,ațXM8cine,etBiochhstrHa,rke@؄оtsBezxlemakif'',ɆnbulpAntakyaeospitaDiagnosi*Hб0aryloodPs0InP'ooolooikXiz߈߈߈߈߈߬yaorbr)Mackground:moglobinopathipa`mostympgenetic)ʈ8raneIresouyf<.ur8t庉nceeveda@8esQnmporhtoд1ophysiologvaso-occlusQcrHbvHs c x (SCA)isPhstud performordtoemhρdinga߻߆WĹCARAPyhHthyubjec(?MePds:ossign owopsollow0; rrpip肔en(3af nfirmPj (HbS)h:O뉙mაhichshowXtabÄixfromerumHResWPE߃(NOMDA8ls)sZomt,Xno΋r OHow0ij '!toX93(TAhɁol(TTL)fdecτSb+o+cځithothCAndBcrisis,hereasA)noiffXncesorrylesterase (ARES)mongroups.

ParamesHbS/S2b/)b>(n=38)Î20b>ControlׂׅTAS(Totaltioxid@tatus) (µmoloxquiv/L`">1,38 ± 0,342648 (bOOO29,915,696,:53,8??ǂǂǂǙTLhiol)_}34,307,5'''''!798,z365,1ϋ0101pGςϋ9Aw>23r17,2'''''#7@`1,64?Oׂ׉NONitrate/n@itm_ςςς80,7@''''''8 5 oo7ooMDAsMalondialdehydpׅ߂߂߂">0.8zy (c0.6"0/707z/tablea)??P..ilool1//0u>,.heek,.eipold҃@s߁߁ܱ߁.arovoy1
,.ong2iQur,tdLondoUnitedingdombr)Nu>Background:heLFest,oninvasivearkerfxribrosisalculafromhreeirects(HA,IIINP(ndIMP-1),hichsEdavailablenuropenHemmuno1™ ()逪assayystemutung`US,erformselllinily (Rosenbergtl(Gastroenterology, 2004, 1704-1713).DVIAÁ(aurreagxspdeveloptQindividual}aramesabeennal@d.utofft 7.79.8cowe(dexusiops##datae 921ixed-etiJample(s(to?o1oefficiY.Wu>ObjxsSE`mv kO2spssessiraly@)؎eanceτMethodhM rial$y-1ύmhHatoH(twooeach (ؠHserumojpatV(184outAremnaz!ithresulplus 16ȁXvt:unre;`VQ])+X(leton)i͆HXP€Pd’Oaboy16Xymipl(bzun𞐠,ponhreduc\8GCpxXi.ediaƕpxI/՛9`,(g- Ћ-BokrzQh ۠06$疏VPXse.rOHmEPaЀp86.OCurx게40Iܕ9?Ҕ-toxtWRʇQ34Nжpisap(aLSIP05-A2rotocolǠwRkl:98-kitrc)tg> (XP-X)=0.995(쀚+0.051,r78(C9285586TWW1.048-0.55662V343959BoatC`@ϊstpXly (95%fide)*nguishe|tity'lopВ1;CI 91-95)uXincep@ slightsigni pnegpve^107ى035)"a`ndH/ (AUps)҅Ʌk0-2"3-6 (cutx 7.7(0.84,15€JQX `v 100%,sp i/1.80ݪ}Oys 0%WW0-45: 9.8H1i1s90w xFy=78.6Purxg=92.3|I84@+?=acrossg>̪o'XP: (RgtP213|11489爸117oCCal471y30y0J1g2pՈMean=4.9-13.5,WRSD`03,Ts6q6DŽف5.07ǁQ5ǀpConcl@hAh defdfirbs89leraC-67gb__urineGAL)dictsKI,linicalutcomLSurvivinanTraumcraInjury7774u>N.i1,.haong߁߁߁߁.Uǁǁ2ǁ>. RuijHospital,Ӆhaiiaotongniؖpy͎a@Schoooihina,WWWWWScffairs,bbottiagnos s`v br)Mackground:INriteveeendopted$lyoro@xtbi(TBI).՗assIishaeidneyyarkmayub0t!a?9bquaRK+.thods:oserume9YmeasuaohortfPnse؈@enroll032(ww|earcHYmisKd23c888XdeXmdActlatHm (,SA)i8nufactr’ؤmend".Ӊoutputustozincide1ordoojpu2008.esultAgelasgowxma a(GCS),ɳ(systol nloo s similar0h#Non-aŌ70ll(gn 𐐵Tami(p<0.01Peakώߎ>80ug/L)xft 3f(zcasYOA87.5%,hi]`ٹpOS)slo`qsapopuXZ7pl(080Abet!pS5)30R.plStȌ8@jgX12ӈ`/lKC lon:ԀׂS'!on4ccurrb(alsoMybenefi)"ustbȭAoH¤bi:piZH.C-688g_[YKL-40̞h9Esʌ HypertiI@Re{#CarotiЁp`Mxa@ickn n(iu>N.Œ,.zdemir,ael,ӕigerli,ƑurgaybAsla@YPltunta@k. Sislitfص{TIH,ɅbuPke@r8)Mackground:>(HT)rGC@Xhro`HPdiBmpani(byHavascrange su1ьe:0aayalHlnarrowpluxУsG.`s@enhowhdsetfcropha8roscl0quy0$=-gradflammatoryponhimtudyJXeui[\[h'^9Q} cry oD@ne(CIMT).MXMethods: 50φτhhoppl ŞişǙǙǙƘyCb;healthyolePtrolbj0ruiǼo hmellituYe!a`o@osteohr@茘idneyblrPex0dthe hypertensiveatientndontrolroups.erumKL-40lucose,nsulin,omocysteinhs-CRP,otalhole؂x,DLLVztriglycerideevelsereeasuredfp 12Xursfasting.Dž{KwithnzymclorimecthodsimmunoturbidDf2nechemilumscencsfinallyņ„eassay
C-69@`g`__MarkedReducxOh9Survi CYP2C19 *2/*2ȠzygofyeloabpHeYpoieStemeTransnon u>S..͙n1,.A 2H.imρρρρ.h߁߁߁,֙hoǁǁǁǁǃRitzׁׁׁׁ҉(oiXr.H߁߁3߁߁Fu_ώׁρχZLonge.ahρ>. BhamWosHspi@oXnxA,'''I''DanaarbCa`rɦitutiTufHUnprsitychooZMe茈OJQ7Backnd:д`elvrcytoche450nzym0tha*rugtabsmhaworoutcȥhgpsacag(HSCT);par`uarriͅ()oss-of-funH2X*2.`iInum񂸁AsQcanYpssifiasx=z(EM) (e.g.1/*1),matwsIwq2;3):poxP!xr*3.bjve:ofooiaveorseutcomesfterSCT.ethods:enalyzedNAamplhfrom 344atientshoadllogeneicbetween 2002`dI8.enotypingaserform0toetecthe *1,**3elvariaofYP2C19.rogression-freeurvival (PFS)"over((OwererminHM,MPM.9record HiconsnRPMroup.esultTOphefou249 (72.4%), 83 (24.1%12 (3.5p],`spively. signifntly-χ3-yr: 2than@rX(5(Figure,djustHR=2.78,=0.004)FSJalsoǃdžᄰo)ersusx3y?93>88Atx192iffnt?82adi@rSɓlv.fdrugstaboliby5,evx`Yn'!dihedoriconazolQurpr.oXthei@rZoncluْgg'$ݚ homozygotmayuPςkhigɆcrWbs@suchs7JThilexndittoxicitutKexacerb(d-)aialSomimmunosuppjntibioticspropohtAٍǣR.ergocarefuonit8llFGs.

C-701. DepartmVascularurgery, “KAT”enospi,nGxch?????'RxliochemOOOONQbr)MACKGROUND:cuteidneyjury (AKI)hm`oftserio؀plrgabdoQor0esm0pairAArR0hfХXseh0at奰ua(Cystn(uh-C)zltubdysfunzظaimx uketil!apag 9mark@ggوZ.METHODS:ɉxsp0(tuddh50ׂ׈ip~h`umspebeʂ (%)t 6, 24j48Xurs-xreXmadex䌘5.xscriianeoplasia,nd-ge8l8ise8,h75Cqu1fiby(x0qle-enha`d(rbidimetr{aPys ercihkit (SMilanЛy)Archci8Xz(AbbottaaeXIl.)th-Xer-Kcoefficva2<5.0%.ӏCi(sCr8deP``*IJaff asS쀰gJȁasame8@mglofila(eGFRpAMDRD皡ہNjKkIkNetwork)on: solq8sICbolt 0.3g/dL@`q.t8I@6pxlyʔrESULT(Tme9(+ SDf72.578.8)ears.ԭ^(20%)Pop؁hfowZablmX8resultpSubsȔQzhocB`s9Є0`H6 /ttable>C-710g__LOWERUMLBUMINEVELST-HOUR`FTERCUTESCHEMICTROKERRELAWITHUTCOME.u>K.akris<>Xx/b/u>,.oniari 2Lpanou.ialׁׁ,ρlezak@Papassotip3Drpoulo. DrtmeHCHXliochemistry, “KAT”enerHospital,ns,reece,ggg1ggOIInterMe///////+@///wwwHAghiaop8Children’sBACKGROUND:nitudie hoprotectiv ffP!serumXbuisZcroke.ԯׁׁӀhumansd.aimpdePe8߂XareorreldthHvHtoutcodtyf؄̊METHODIn`8spDiwiclud80atihljSDžmurti dsio24,рq72 .ʂJ Hform`day 7X' ArchiY-8200`yzer, (Abbott,Il)Lntra-Xer-Xcop Bv@h0.s0.9%ly83BeOOLRSchvianele (SSS).un`oyg݂Qmodifanks3mRS)(cgorBo 3'group8cgɂ@-se:0ʀ 0-2),xt3-4)ʂڀ߀X5-6)ESULTAtabsumm(zuly`g+)SDC775H68.8)ears@w(y (2 %)d`aollow-upiohf 1Jtased`mHjamoA=q@betweeurvivonon-蛳Oha0ign tlyig(p<0.0001h?9(3.95mg/dL)tHp0503."decXa؁h3.4Aaduntil7OLwp򕡪TheffectflitazonesnevelPfsymmetriciHhylargininenype 2abetes

S. Özcan1M.. Şekeroğlu????>. Yuzuncuilniversity,choolIMedic,epartmeBiochemistry,,AN,urkewwwwwuInternalȄSelçukwwww,onyagjbr)Mackground:Cardiovasculervsreleadingauseydeathtdic.hereforitserymporta`tonowXaB0irugsiln(TZDs)x{glysxcrgbimhXstudyas1assesP ԃriskactorndxidaApwiwsMods:ourtywhorapiwXodifiedyd:e(pioge (Ip 1)xosi߀2))t0i8reviouZϐ8bservȏpreanthBloodamplutakenډafaJ.Êma(suchFdGC(ADMA),sCRP8omocysteჩlipid𯀍@produ8onldehydxMDA)Sgge0`10ooooooob>H؃?g774/tPtr_ZAdults (Q18o)GGGGA11,194 (21.9%'''''#5,9 (31.1'''''#23,889 (46.7'''''D00.2W/WWomen߁߁߁߁8,110߁߁߁߁ߌ8478,585煚2ljwwwwsMׁρρρρ3,084߁߁߁߁߁4,071߁߁߁߁߁5,30߁߁߁ߖgǁǀwwolesc (128____온3534.0d245Girls߁߁߁ߙ߁ǁǁǁnjS48ρρρρϞ/ρρρρˁooookBoyׁׁׁׁ7ǁǁǁǮ6ρρρρϋS9ρρρρϕZooookChildren(lt; @7ǂ___6@3'W!095 (567 ׁ׀oo߁߁߁߆LGǁǁǁnjǁǁǁǁ9ǁǁǁljooo߄?ׁׁׁ2Oǁǁǁǁ6ǁǁǁlj{ǁǁǁlj(able>C-74gb__R20hipgamma-gluylnspeptsindsfcyndromyoungpnexsdh///*u>G..YPNIEWSKA<>1,..ANKO77777`,.OLLAKІ(AJI2>. Colleg9Meu N.CopernpsnrsH,YDGOSZCZolX,׃׃ׅ׃ׁCHosplׂ br)Mackgrd:TheXɞ(ϕobeCul@rsta ϖϖϟxv(GGTP)JnotfulHclarif0.חAvestigj@soci;acomp@ntox ʆa.MethodsR,a((cose_Ylipidsrter(ARCHITECTi8200)2loodambɁhfhe (n=98;BMI≥25kg/mO)agP25-40rpge-matchhealthroP39;MI<.nthrop c0asur+p (B@wr.ɓwssus HOMA-IIn 598bjec8א(hSH(diagnIntlĺ(edercriHia05)etex"(>39/L13%''eAz22م أH(17: hHAǑǘar10A ;0,0002)WPout(20vsЀH߂1P1,poio (x2wapr, stjtBPdoosigncahyt8rS!norP^senBz2272SimilIgf(23More( depe(XtorB (β=0,35= 2p234alsoPْ330PConclon_ȉeȱXe惸sxAOtisk:Omay8siafȆۣ?=.C-75g`__ValueYismia-modbuh,n1ycnlrs(eu>(Shiesh10u>,.hen,فׁׁׁׁׁW.saiׁ׵ׁ. Nzxgu(UnxThanBwA_____GGGospital WBackground:ɒǒǒ(IMA`sHrpctesParker.cIstudyѪxtjJA 4-Rsee1xrhsٗgyhods:ׂolʃ*dfunoHs0dbilirubihild-Turcotte-Pu8(CTP)` e -Xge (MELD)core,nternationalormalized (INR)ndHdocyaninereenCG)ssessmentfȀXsithhroniciverisease.loodamplesromealthyolup(n = 51),hetisS14PYcirrhosxˁ 21)erecluded.
C-76؁g`__Incidancefa@imediranIfeAgemutschildaV@regAЍ"ahip1. Yuzuilnysity,choolMPc,Ģrt}Biochemistry,,,urke8SelçukWWWWWW,onyagj5Background:F F(FMFhsutosocЅ(_QcharacHbyqÚ@flammatorytt(jthe usmbhicaXpobdomin paiۃjoi.vÞ0BEFVa(bexshoworespibleoViphyX hology%$`emXqlextsknX`de⪑va{alsolay@ao(܄.ԀhaimÁstudyscr 128jЂagn @evaluЃڄڃxDdlop?` ing쁉#PAqpak Me8ds:3id157ag5-15earsύHvQtwo0p؀(n = 81[76cda`rlinicfinуI@dH, 30O"􆛄u.͎vbexnahhrq(hybridizj|IL-1β,A628210NF-αCRPmPuboǁ2oesults:A(tȃ66,87%had,+42,hheozyg, 11,5%Q1om~cmostrequl8b0vE148QQ(22,92%)0694H/(8؄߁8,28%)llelv+d(d3(40,0(32,41DV726A1,7.urr!,P֏ϔdңfig 㧒W(|ϡmccoσ@(p <0.05hW?____ׇgfsignifPڂϊ_'톽,001)o!n_supporɂâ)it6//ientsithMFndavehownhaturatientsaideangefutons.nddiq,ts(oughtj,0eevelsIL-8,NF-α,RPespecially 6ouldesedeiagnos@acutttackmonitoringjreotreatm.owxrpnccytokinNpassiperioEupportviewqsubclinicalflamm:sntinu-.

C-77gb__IMPROVEDRCHITECTHSSAYORETERMINATIONFONCENTRLUTEINIZINGORMONENUMANERUMNDLASMAD.rams<>1M.erAbbottmbH &oG,iesbade8Germany؃GGFGG,Japan.td.atsudo,˂br)M¡ground:Detincrhu8zihore (LH,utro)9instruxforredovuljq evalu0ilitp9ggpituitarygonxlsorder T_Xay!ahemiluesaic aclR(CIMA).qua`dω'''"Шxsepla. m@wlaunH2011llowecustomeoMrrpracpatchɯg,aliborxhrolnCX6-poiSthardÂ񃐈whichpeci;WHO)HHPN2טטnd>PH;80/552ۃ runthyxmػavailab4.VMedsrs 1Lot-to-8producibgf1Uٔ ssjmuraX⽒`guidaromLSIPotocolP5-A2OK`lldx2=ot2ts(l3two(impdHovHa0riod. XSۡd؆d`(EP9-IR)107niqPspϊ{0250IU/mLP``-BokPgrem*.ӂi@(e.gXimitQ6(LoQ317-A)pUBlankB)ͬ؂D)nearrl6`acacyyPcI8ϼx` estis)n (n=199cycl fe64post-@us124)wResultw>to(Yoyms(%CVX @9Ғ0Yla@dh` ( y @s؄ךЛd#s L=*Di3slop)???1.04 (Y=Ax -27)`coefficir99Csdep (\<Ћ7%bso vi㋪<=1ݖGLOQb1,1%8q7wy5@V./B5HikBknow(|01.2%ChlonhuXWVshowexcellGA8@goo'kCEo.ighQ8WTxowsoflexŌ@managv@;tc gibssoongerequired.heRCHITECTHssaysaluableoolnlinicalaboratoriesor8accuHndreciseeterminationfumanute`zingormone (LH,utropin)cserumlasma.

C-78gb__NehilelHnase-AssocixdipoabiomarkerAcXidneynjuryurɅafv0Trans ntru>S.m1,.eong,Ӄǁρ">2ρρH.eeρσρׁρρρρρG.Ӈ/ׁ3ׁׁY/ρ">4ρψgρσρChunׇׁ7ׁ׈Miρρρρ. DepartmeLyedicine,nsityUlsCollegeMrA递(Cereoul,orea,epublic,ׅׅה ׁׅIJPaikospita eyGGpoyangi3DiviswwHtobiliahSurgery,ćO׆׌׌׌ׇOOOOOiOOׅ\Anes؇logyJL''''''''%)brЀ)Mackgrounds:ki(AKIacom9pK0isndergoqltagnifprognost(fac ir0-ute diaKIb(dcpغsH(Cr)nc0s;wex,|C؀lsootuntapximxlyalfQfuncsmpaired.plXmm(`KI,7g7a7l6(NGAL)80eenQ,ardete.؀studwPvaluځ;𖐈yh䁱g+f)-r._M0ria8MethoWeasp(ynrd 19dul`with]fprtoux2010"loo@Hcsaes (Yat 2, 4, 6, 10 @2x3`4 !48舌reperfu)reXPc8.Ao(viewL’Qron`mrecords˖f+wmuؑ‚*NAGAH (Bio-PorD0snK)z!ARCHITECTՂsabbott USA),؎.L]r1҅1enslu/hOeffcYIIput.wdefdyisk- -Fare-Loss-Esta|dis(RIFLEriJ1a 50%r!xj.u[8Pno僰xsh,~EWPoϟswwu,Vy/ƆOJA8 YaItime m`ȃwxsءgeQ (e:fe952؞pg39-653.75:173EI0uςHPWTvr"d³:_\eakH4irKm??pedv019.0C 0-43, p = 0.011TꦊLL3ʵ i ,itglH(tiɀsignifhh(75).


C-79h>gb__ISANCREATICLANDFFECTEDNTIENTSITHEP9SHOCK?u>A.arassi1,.ezzill2Imbrogno.abbrׁPigna߁߁3߁߁Morse-LabGGGG.ii/CoaldeV0elzi’Eril??'?>. Departmx Medic(,urgeryOdoiatric,niversityilan,C-80gb__PrencedesGloulariltrRa(< 60L/min/1.732)nenersxpopmSpaasstim(diffPpredicreq#s S.arcialo,.arros.ernanezeiva, edez. HospitCabuGijon,Ӂ/ipr)Mackground.hro(idnesQ (CKDssigppublhhealthoblemhodiagnos(gingliesp(8GFR)-D,to8tere2KDI-bstud.owever,t莘beenugghatPqommonrialdlop@fromamplwip,yhyieaisleadkynxT(aim9our:y@pa I-EPIMAYOÞuadc (MCQ) MDRDۀ4-IDMS,6]QArianorcoas.oMethodWenrollP(si1nd) 9adp[sex: 542@ms (56.45 %);ge:50;ѩ18-89]HnAm8ua(lkaicpm (ROCHEĘ+s)じbqceaisot-diluSasppect@etry ()oҪ|ЗRe 3@::Z8.6%;0X, 7.7CQ, 2.4%n (%)'&22.2% (88.3% 3a:)=45-5973N10.g`12.9o0hfi+탕zur(ndarzppeo@_wZ,ic'>onclusylpp8new+߈ reclasifo2 (her)ɚ@Xnumbȇ ix3a ߽߶2׷ׁ_^Toӝaloglchanismheosyndu>G.i1,ٯП8X.i@H.ong,ԁuBY@J@uDrt Labo(oM0,pChм3ich(nisityhengdu,k,r>OBJECTIVEH (HRScaʍHsفIvasocxtriouruc !Âbsplanchaperip,L9 decкHxffXPrȕolu8hyerfC-850Pg`__Selh0Labor)yest֏ꌁJOuediXopu 8, 200009σσσu>Shagian,.ħlspach,Ҁ`stles. CDC,tptGA, C-86gb__Auto- bodidisulphsomerR-609axssibliagnos9mar@maimmunologlferty߄߄߄M.ijak1Janetzko 40u(H.chuppeMeinht. Jus-Liebignivp-DH.Aomy &ÒiayH@se GerX_____GGGAUrPaHc/Andp/oBonn-vAt/Dtلoooo ooDRGɦpruجGmbH -ҌDpart,arburg brX)MfPQ fecege0tractaveenporapQ15%#ssaeـ肚turbances.jor;x owr,uh8dyPympcour)Pse,speciubacuorhron`Acondiɸnу/epididymreobscurDefiXasucг׆bdn`vasiopsy.yroteomap`achs 2D-SDS-PAGE{blooll"mass r,@ fiHthreP (,InsriTCP-1)q{dn0ti؉cogn072`sH>th.f,4w9lsodґ@mHQao!8l9exiɘTotablish ˔iayigh`pursmbhu(92) sel{uyfȃQLISA䚨lopIHYÑgrouphPcned:ealthyrmozoXX` (n=21,Hl 1);;odoБX_Y2X/)impaiQse quaBaccord)@WHOealueЁou2/18,3imiy,RGGGGGn=3S4GԡG?nfirm[/܆245Hfterhaxcorapⅷ6Dž˩ o-orchx؁7)/ificp(inPti@z/+agstfou)(t (p<0.00q؉LϦ3HXqoy"unknowntatu w12).Ã?,xyhrɈ-ERereeasurednheeraromatientsfterusefnti-inflammatoryharmaco(rapy (p<0.05).yER60bodyisumamples˂2vestigatgroupsidotignificlyfftho#ycontrol.
C-87g`__Iև enycertadfectisRgen@qacziG,H,J󀂉0tweenbralopul edltaff u>y..iang1,..pm.o߁߁߁߁..e߁߁2߁>. ؃ׁ׀Sed؉yaospital,ÒЌSouthniv`ity,h`sha h,DepartmClinLabor,peo’sGung,.R.g DNBack)xobj:SeȕincreatolȗPOsavedescribed. wY,rsqErecPPid@edG,ȅJhi>A4monsIhumansoes.htextiȅcomWWWWRxhEphylococcidoi,e폈minhibih18BbenzalkoniPchlor jhexidineurˀoioi0P]Â:pP9RnehYin>ed\: 300߉8mbw&ici͐,BaЙ!865ouA.aureus>` fea|nPpla-coag sero遜acetoinbβ-galact(dՍpolymyxB.o*PCRasquirctE?;*mߊ?8.nnonfir\barryaXXfourx),ÃA/Baherosفsmrzom фDŽ߆قbgf ".žċ߁܍GGq7>WRS.eprm؂.ͤggg(MIC) !nbrXluJ@me77775?>؊oOap62.5g/4t5wlpˎYAll?ǃ(susceplQuinuprPin/Dalfol,̆`zolidi(floxacImipm:Vomy.ҞFux d(33.3%)Xlinda(55.6Tecyce(44.4%)GЁ\Rorve4igncdiffP,믯e/,hich!pobabassociBwi/mechanismR]?> clon:Ԅkval퇊`lowb)76ɷ.owever(shoulpYiyrRelyEinf_wimpuȂXcreu&icroorg.

C-88g`__DiscusHCKD-EPIqucMpemglomerril$amomixatients inouthernhina

R.v,.n,ـpi,.uangPeID.uo,.ԀՁ$K.u, B.ing. Departmentfaboratoryedicine,estsospital(ichniversity,h@d@jx/i>2Tc-DTPA(usm upa@misbetwYdoneiascyRBl0-AltmayHcalcyP؅ɕhh b (?????>~ 78.2ml֒ςגςǂLj72h30%5@Gz-2.7, 8@%, 93.4%pect(ly il2tor??870.1%.plo˄shpYSTZessfaccorreӅ(r_Z75__ٖXpossib8o=q{o:ɠ,Gpp`JiBo:y/uHtиQaɑ8Bamime.C-89g`__ozż8dystÈ/шgshLv,ڜ,ـpi,.uangPeID.uo,Ӓ`Ձ$K.u, B.ٮDetmiLaboMedic ,׈PHospital(ichnXtXc@gd@jx/i$oBackground:?(s-CysC)葸brepor“Șdtialnveiltmarknjă1r0- pi`ex)֘Jpc`r7 qimsdexopeIZn dirg chronicidneyY@)MRSږ8\ 242ithoHsdysfun `aYLYidu⭡!divid 0twopoupsA 17~byhPip8larȈЫ9ys{K2OHify܊lllx7togHϺυ'wk̑oҭJhp[*()67.9ml׻ǂNj$pR1.21mg/@ц39g/dl+?,WtG7ationsasnheangef -4.4o 4.2l/min/1.73m2C-91ȁg`__Refnce0tervalsfactors㌸ributpserumystnÃWWWTu>B.قDepartфLabohory͋inxWesthinaospital,ichuUn(rsity,pgd@j, 20I8i(hdedjuonȒ9Kҙco`1((β=03s7)`1ro rxcH8ZleaΝcyǛWAvolv3IfulPƳN137.6%)ힴӣ̄E10on 95%/yopu)ythreЙgori)Z1~1.13mg/LzaV/1!;74ǁǁd 6006wu20-.Cwasignif0nt@萵uo9H.es81 moXڭimg((dex0110"`(="basee"334400/0701?=b>C-92g_\ardiacropo冀2sllown\y a8 OOMu>P.avsak1,.חh,ӷ0r0n3LorlusǓPuseׁׁ4ׁׁFotto߁߁5߁߇Pet6[McQu8oH ׁ׏7ׁׁы@ma'烷煛rkobrada.Ğ(reaux. McMasterniversity,amilton,N,anada, 2en"ahighen(hs-Q)ssayseir3䀡OMssiprevalinjuaett.Meds:Б5(n=299)nrXebio-bankb-3ISIONӀ(apcohorЁ9)atadrums`ag be -80C)n1,2,3׈weh`@fxt.spclinlValsoOOOOOOL߄dɂsamedž(-1;x80;)-2i72k3j5).eȈ ύxmy8 1Es2010𬐁a (鍫pool (n=12g/L;=32)V=15%Ƀrecedhcp0H_A:e!a>C-94gc__CYP2D6*18`lymorpmEefYcDonepezilAlzmer’sis؈Tu>S.֔kan,.irZMuniPA.aiswMπjTrihi,.agary>Alln000tutMedScpces,ewel , h$oLJǼAD)aurologo`ʾaff@m( q|65eackaccuexagnicrke@0;PПrap1two-mppHoblemshDgؠ;l8GTsymptomcreatmwi(mil"moɃxmeolhdecoenzymS.sٹ!take`uɇQWWWfADƉyف73;؆opoSMVuidsP⁰bo10g/daip3onths. ThenalysisfYP2D6*18olymorphismereonesingerasehaineaction -Xstrisfragmentwps (PCR-RFLP)ethodnlindedash.lasmapeziloncxrawaseterminHPLC.llubjectsrwqatandardizcicalvaluhichclumedtoryognitiveunassess[M-MXStatexaP(MMSE).Ԍ ppro، tstudyorxperihumanobtrom lort s8mmitteePnDŽr.rnhQs91earxwuh(aXrelvrleggux)c clyisablith8iiaƔex ΉiRy+unwil gaunolf|quir*BV,asifhA0un`n(.
C-95hg`__E,XutilitPx-spec1'labo8rerangXsքu>T..ots-Wilson1,ÂXraft,֏ppraPuǁǁ2ǁDžF`z߁߃߁. E0yn8rs؆tl8a,A,ׂׂ׆YׁׂaliniSF ci@)2@uGGEBacknd:Ôprace8`9鴾Xc`publisha[HyqiH7nross-sexor8³H,ncomdas|leaiأ#dilemmahRPwhat "n8al"ReachHddu˨gostudZ㊘isthZ؃2,u ciwhe o Hrome-KeHcMshrHŠxoiiadeecQrsimp xariesiphologducbyd~̓(ods:RBpproobtaghŝwelf-4iXoeSϕ_X/>6thenrollata:absctr9me1cords.rminaА)Lغg(o3 25Kɀ`lnon-ryjesultփ9hhtocr཰embфdlۄYsignhdi8t<+(p<0.01).onzlо*A@hs+milaHof,ui'''&WhDL8ole ςtxomale (p<;0.0001)ndheemale (p<noranges.ll`ralytesncludingemoglobin,odium,otassZalbumbloodreaitrogen (BUN)!kalinehospha脈ALPanthsferTspartatS8lholesteroladtaboverlapetwehïL
C-96g`__EvaluɃ0rker"type 2a}u>S.ˋ1,.ho2Mimρσρ.eeρρρρΌKyungHeenrsityȣi8Gdongeoul,˓Ha,epublof,AMedCergggiOBackground:đnephrohyjIicrovascularKdevelop*30-40%Gqȯ ocidthxhisknItn1phȅHodfailPBde@iiPharacdy|uriathou𚷆wqxD1,y CstʬWduo0idHXxsinumb٤*GHow0( tusЌikidneyunc(gesuf.huha bief oi(outH8ВP@ai.`c,Aipsucseuthileln-A7Lipo(NGAL)N-acetyl-(a-D-glucosa0((NAG)invgjdettdamagarli0rado1g`PwxlanneP|IzifYhiЏ]Қ[am70mellitus (DM).Me0ds:Ȧ210wtDM46hl vidualP)enl8twMarx20YOcto׫׫׫.a@LJUJACommer(lnzymePnkImmunoSorbPssanaryؓ쓗(R&DymMiapolihUSA),__Nito,oky8Japanc!Ã8oche蒐`m,rmanyponɄ)Bqsubsequssifiafc18qx@eB?glo:fil8GFR>PsultxT0ɅH55.79re 34~81klfeR 1.47)aanbopweXt,kmpIexhemobA1c68.07g, 25.58P/mP
=0.007MHoIaυυυ̥ffncHmorm9opKWh҃ubȗrdhwhؤhapo1rh(pxhxSo? wrϛτd_Y5p qy.02Conpatients withenalomplications,GALasignifntlyncreasedPype 2MAnephropathyhanother_Y (P=0.005.nrreltudy,XereZnowntssocicamongTmarkers.
a>C-99gc__PH݊NHY.e,.ixong,Ԁuo0.a@J.u. DrtLabo(aMediWnaȺ,ichuannIsH,hengdu,k, Ȉ5^Obje(vemmhaqau@neurotoxty(enPat(all><fontize="2">3)shenlyormfmmoniaat ableoree8pasroughblood-brainarrierndauseerelysfunction,estedhypo@srconcentraunHdxcorrelaIwitseverityhepchphaloxhy.ׇRllHighan(o8pׄׄу alkq)moȈPpW??.¤O_YsignifntH疩degh;ow9,rcoulXsefu(iagnocro}too GGG

C-100ohggPREVALENCEFEPATITISURFAANTIGEN (HBsAg)NREGNOMATTENDINGaENATALLINIC (ANCWHIu>C.KRUMAHKWAME]NIVERSITYYSCIANDECHNOLOGY,ˁ`SI,ǟa,8i8GBackgro :ȌRtsbabies.tthteIeirivE(Thoppear0mayriskJsheahblem)nfecYnewborhav‚(890%)qbeYcarrier(7conduassesprIᡷBrfa igȐregnwnXdenaWhie ulbeamhServi0mpec8aryPaxcurboBn`.METHODS:unpkanonymmedڟclosayrom 269ᅨIre8ge3 ж(;lot*cXrifu3000pm5inutberumjenY4s%:1ACON(@>®p>USAhatophX8iespoESULThPer XrHAva p15-19(14.7%), 20-24q8r5-29(21.9q30-34(5.6j5-3t40-45.4r5-49(oP񃡭majorx1crنsexuy21a51ONCLUSION fiowomeneropositiveorBsAgsignificant`ncebout 10-20%fnfectedomenillransmitheirusoiirabies.vpthough:CDCecom0dsmmunophylaxXtogeHrthaccinationoroeptBmos,Ȁnotone(shistrictospital8nhanafHtld₈adtrovidingȃɆglobul0(HBIG)ourslpdu+chi8dssP.ascreenyandWPadolescenPxpremarQgeaaimpa@fightainЊB
C-101pokggEvalunrt-ermgn؇:PJACLFgELD,2-NaImeldWWWTu>G.ao,.hu. YI@DiseaseȏNbo,Eh, 1

. xiXבi>odBilzearchnt,airo,gypt,ooooo2nIsxǂāɭEBacknd:COI(CK-18)Ireld#rodus.`cudihaXiHcthaerumeJxulhlysefuliomar`Рinjurygbje ׾aimcyZtorCHǣ׮>sr.cflA9,ibrjiALToeds_ťywluX; 69קׅ, 11cirrhpo_C15alth!dividualX^L2psQRusedoristologicalnalysisselsormmunoZchembdetectionfpoptomarker (caspaseeneratedK-18ragments).pquantifiinairPserumylisaechniquedniopsyamplessingithonocloPtibodyz.
ChronicCVroup (n=69)Mean (Stardpviaq)*irrh ~11Controlo15oooo׋׋׀">SlevelWWWWQ27.59 (13.4761.73 (28.0617.40 (4.5G?GǂǂLivtissexpressw03.1231.08////38.6464.7p/////(5Í7/j>ւGGEheT 1l7778ItcϘȬs8clyssHccts (p<0.05,\1espy7-Xj8_V〠('g߂ncreLJñ srity#inflammځ:tag((fibrO׉׉5)/onclonlayo@)iVdisogגpHûtiQ .ȓestCneoepiesereb(vnYlscprelathtode Gaa,hicayointutpobilċ0nggX ρcoX酕^ef09po(forhtor9oj.1נC-105o7g`EusAMPAReptid(hAntibodyiomarkerilraucrainjury'''$u>Ahikuev,Ԃkoromets,.zykenova2U.anilenkoӁmbi>3>. Pavlovt͡alns*St.Htxburg,uFeder,GRACEaboPes,LC,ecaturAiWȬrHlleg*HealȖHhnyvicKennesawd'߄Backynd:͘ (mTBI)@miouф⼈cer)Xonlead1caueaa,廱ipyggdulXougvailabmagechniq0(CT,Rphavraŷtxsdiagnm8#,kjnnotцЂdpccurrbarmaj&,osymptP) aІnorTstrucȀ anqbjmpht-Ȩ然thatI1perm{anyli0Cy`ext8ehelpfulz.Caffl8rzchemjcircuits,eadingodema-activatnecrosis.MPAeceptorsreeyomponentshatntrolheserocesseExQivemouoflutamateGB,riggerian6influx)calcium,Ooverexprion_/inAtra-synapticg.egrad@ byrombineed)teasul@0pideragmj( bloodstreamiaɃ is؁-braXbarrierRփvaissue-b0dvnceneuronalysfun؆duemTBI.ԃobjeYstudyoandantiboxlevelmildBI`yhealth group.
C-106؎ohggIdicroalbuUriȌaD#Hxolecularׂ-adi!Hytens1P(plSynd(eooolu>Q.ng1,.hu2Kuaǁ߁߁߁߁L.ׁׁׁׁׁp>. UnrsiSaskwan(rooYK,anad0www wwJinCr(HospitaldongՄf,ʁi`=Obj9ve:7amsSpknowdepe(kacsoridneamQ!dopxcardiovasdisittlsTHut `bpXc(nWR\rThx!iHguria (dehp9yCR,Hary @ iosw(HMW-ADP)eo{SMirPrrώMSubseth`(toH 68enled, 35G:jH@L33a*lucose,\ie,B-0*lprote17XDL-CtriglyXs (TGя0eS cid[ ЊQ@chrhLX20 (BeckmAPaloltoA).lowυυυLʕat:HFriedequHMW-ADPaseterminedsingommercialLISAit.rinarylbupmeasurbnmmunonephelometricssay (Siemensealthcareiagnostics).
C-107ohggStuhplasmammone _xrhsu>Gi,ٝXHpuo,.a@X.i Zg. DetLaborayeh,e8ChXspital,ichuUnrchengdu,k, C-108ohggDyopm)ofxlgors APRI (AST,letodex):ELF™ (EncL9ibrs)ԇsYdetilF0-F1t2-F4)uechr@c tC^a8 u>H.̟tnson1,΂nyder2W.oberg3J.arkes4S.iaoׁׁ5ׁ׃Rȍr؂. UnQy!TexMedHlrhh,alvon,X,wwwуwwKey-Seybold@oW1y`Intut`fSc@ceLondaKdomǃǃiaǃǁPublXHҏoumpt''''#''熡Chge,Lo,ɲ(ꪅBackground:Ա9pss]*(Cir(HCV)import1fprogn!.hiXci؇re*cendardsW1diopsvas"ocisl1Ur-ervariabile0(previfb)ccujsh@fhIGCV-inf(popu,児alonzcombin]omrhobj8ፐouHtudyB겷qcXGDmhne_siesWthods:0paispc191whloodrawsgaer8monҐxexxcivh, Qjnegpxj@ZvaluAURObseataus!oeneah1ful߂zdifzt ~wResultdistribuyge:0:21(11%),1:68(35.6r2:46(24.3:24(124:32(16.7%)ˈ;w0.865P33,x (p=0.312oꍇgg883.2%B80.0%+72.33P.՛Ihpriy*,llow؋,?woujbeebzcreaumbxh71eavI54(28.4%+:9`oncl ona(1ӜAa>C-109B.oudel1,.yaw@ 2K.adav.ig߁JhaρρρρυRaut Manipalollegtdlcceshokh,ΠPl,1InPtu@=athm@ubr)Mackground:O!0ornutrir0xdaryPf(yl ootusms(PS@a8nowImndhlopycPȦ1TesqstudwhichaPkedqSs0(CKD) p!CS*IЭ`ishrisk(ctoHeĈاplay)various''m0eBeffectndž3lbjB2udyasfue΂e@@OOO@hods:T0pitdhs-soncoct D)tm0 `*BiochemistllhׁIa (nepHlogynitTribhuvannqsityedH,,h(TUTHOMX2008ebru錐9ug.ρhr:ix@fiaiagnHdwinclhl.qde0؆eGFR<60L/mp1.73m//GosurHbG#g>urinAalbu-ct8gth3 g/grammрthreenthsn kf(NKF)uipAropxca0eskR,hDaircumfI(WC)su:no$ami-@ro-Hma.a@blooample<:imK luc (FBGhglycd9G)RHDL-chole@ (CSpAdi`\;OP񯧯bsodifiNCEPTPII`i)HAccordroBreport,{ pa ho𑺒Ue8llow򃬆": 18bdoГoberWC >102m xʀ88wn, 2)G ≥mol/3)҂@1.03Ԃoh29߂4)stbsbAimHgaqWWR85J5)BG5.6curtly;i-hy(tensry8be0PJ(h@ok8es,spkl@wResults:S(37.5%yG(ǘ/+'!zwoЅ0TTHd)h70.0%2(6.2A6 5%18.7XA蕓fO՜ǜ,hoZ@uh73.34XAah@ex2.23%Y0.27de鈣55.1BPh8%).CoA1:X߃YocsɈ-Prd7tpThowerrevalencefypertension,yslipidemiandighBGnKDatients.


J.u*PDept.Labooryedic@, ngnanospital,uhUniversity,a`ggfggCerNSuiz,,V.1br؀)MACKGROUND:Ӗmrenhjcyston|sremmonlysedဨeasu؄prehunc yendogenousarkigf(GFR).lcracxe˃equ̝FRZo 25,nochb0lapplicableollop8b,WV9Xanh imYtXprtudy@Xe-our7hichaɀ(b`fÌwithexgXe@GG>4b>)_GGG@3GG>)Jouh Ocohor.METHODS: Hcarriq8WPiWona.rst,arirretween冯1,2,3,φbbiologaramep(SeHdnrregPnathransform Sblooditr) (BUN@򊈙ބ0oints0Yubsets{a WfqeaXl؂1rootAnxrror (RMSE,$esxarGGGEESULT58%pԇʋ56.55 ± 17.28PartiX(ge)I negvc atx0.5.Έ//*show`twoڎIfn < 7mol/LoHab≥+Prdrom膲njnjǩ">2ǁǁǁǁǯgǁǁǩ7ǁé)WNtccuӈg///-&g߁߁߅߁߁߁߁3_b>߁߁ߴ׈وE7CONCLUSION:ۑhimՖ1ecannbhpXcablitsҳpopuS:ƢUN,periorityfkwhicombYrumyÏCojq`8seemso؈xȀ``.Ʌl Pflec1 *Csppinguthor. Δ PnHbug@8uppong:workӀyrGi؈HJCu:κScien(Fou`Ȏaa (NSFC) -30770658HealthyepQHubeiX3A18(p>S.ÖĞÜT1,..KCAY2N. ŞENׁׁׁׁ..ZLU3臸ρρρρO.. ÖZTÜRKЉxİL煳KANAW߅ǁ߁߉uKARAKAŞ9İŞLEY߁DEMİRYALCI߁牷. Bezmemakifniversityacultyfedicine,ATAY,urke ߃߃߅߃߁Mustafae pYuksekhtisasduckandese0hospitalbrh)Mackground:eutrophilelnase-associatediplin (NGAL)sromisingiomaxrorcuteidneynjury.HcXlt8concludthat΂ayesbeyothe1aries ren@physiopathologIfaoAanmporta`factindirecItribuxgYinflammaXycesses.ittlsnown(g9itsHto9nT-semH (STEMI).hstudvestigɄ`gnocalueQ`0iHsthЂpblu(+p!.gMe8ds:106seihonderwperaneouAronapintervPCI)j{Y50althygdextch voluer)Ȍ녻cmЏ@Z@e9cl@ifiMhlow1pwhs:҃ HnjLjHh{u ubjȓhIn-htRone-y0align`cgre8_^",(mpa(9Lj„pddi,X߄߄MACEWWT猧Crn:HLJ#po虴qfwόțrJY9ca@>=HteolyHiv)Ϟ`ablishaHowȩXurrjlargnumb8fnfolP-ȅqu ʅfulnJHmalݚpopC-1140PohggSꉠeship`tweenؘyptreheHosyndثB_cirrisa8 u>H.ӊ,ǯq,ٍHe,.i@Tuo,.a@Juang. DrtjLaboPMinWh Wich(nprsxhengdu,kOBJECTIVETonETHODSFifwoǍ/*(Na<125.0mmol/L)100yr*normAerumodi8ʾrui9fanu2008 Nove2010,H(u,cqlxn,idney ,ALD ,O:PidencHRS\TESULT0Xx378⊿aas 122.2튲,on!̓!39.8Ie/A26.9%,hx鹌t (3.4%)(PI0.05)Sooqs 48.21±25ngW23.817.29 Sofhe laboratoryatarehownnable 1.
a>C-115okggPerformanVhi膁iChemQ®`VcityorUri`yTes׃׃׃u>C.uon. Ir InX,ÌswHh`A,iBackground:®AutomxdzestSЎa>u:c>,nitroeasu菄folȈAatesy:ilirubi(UrobpniogexKet(AcHa( Acid),scorb,lucose,r(AlbuminXBloopH,΅ipandeukocb erh,p`fgrapy,olc.\wa`㉀)co(raɋinusurXtlyUn@dt،@e8@orunXes_bjeTovaluu7em,0`ga$?sd߅sxuxbecPa`dȏ)QɉlIQ200oethods:8udwыugeg@cspik2ٔcreachcoP*"o+\nures d(reimQf3(LOD)"y4Psshi( YAp,w'Ppxozd!·alsoRϋ.fς8bo(@), 1594uH؋d$arfrome`xhibiaosX;aɂqzca9b?tQއ(fY'@®100lA)zer,JArkrAUTIONAX™X-4280ς///8nchrCX4íq'HhɆfrac耡latɠ'#S abuآAɫ ordzbetwey_҂:ƃ2;*setaՒAowТtouldie0> 67%χ saccepcriaʜHkequgQH≥) 90%ءM[pa|nvi plus/u.πxhundq'߁߃ri.Ō9g)c,xexI'??Xgg,y 8ВsudisplexHdc ϋ+/- ()ߍ݄??ͰOD94.1%,GDmo~ݸ 97.8%NCȊؑ :Jhexcell*!isabQrGbeutilizȄHUnStXɌ+in-roasurҵe.

C-116XxohggLseؘssxfapasmalucan-diappopIeight="0pt"idthc>M.risaka1,.otani2>. Iwateealthervicessociation,orioka,apaoooooDepartmeoflinicalaboratoryedicineXichiUniversity,himotsuk1br8)Mackground:umrensegardsiochemzmeasure1muscleassolumndividuals8norHn0func.cstudyPreportedhatlowcanepratype 2iabetes8llitus,uggesgmpaiЅ@su8ᄂnlalucoseia$Os.Ԃ(aimhPwtovagqetweenanda'"(FPG)evephgenerX e(popul".Methods:smokhabitexerci؀bo Jex (BMI)loodIs`hol0erol,PG wehayzamo8non-Sicꀉmsubjects (3366p:2347e,QgZ51ears).΂c_:defЄ0`h< 7.00mol/L,ZgX1.2g/dJnotcludyӁonЅفҒhiquiran8 (Q1-Q4romXhighX)=sisetIn0(zqe 5.35pو߈ـQ1 (r0.73#)/,27]Q2t(-(9) 3038087)ʂ@9.4- *,psply (tXs0.05Xwo 55560Ȉ61(.01æjx#7Ѓr*signifntvȚugKo(rf)؆/*Tdjuؙ (5ˀȍߎjClusߋwhRahaymark(refl;1Ѹૄ]`g@s" (.urҡieedrm applلW}n. &prce.

C-117(ohggMagi0suept8X@xrڏl+pistaqhhrtenspЃssdisgggcV..ay<`>1Argolo//,2//0uHJ@AiraetWWU3WW0A2Sanjani. Riyan oӖenrsityisciCfExilaphgȂׂ,raziloonooDipósosamérh_____[__Lipidsabo@or'%)BackInd:lx|OIh o m,8htribudopWWo:*indua(?9ƻsoIy鱁0eff8!@l75m-erythrocysoЉػgpary߫tsreatedithhiazidiciuretic.
WeddayM,u27@a8؂b>PoAӋH  10:00@ - 12:30mha8 Lipids/8oprׄw>C-118o?gfReship.oxp(a#caaqoscl1؏xasymp肈cubjدXaXmparisi)nLpGGGDu>K.otani1/b/u>,.aa2TNguch߁,.akurabaya 3>. JieؤUnryxhimotsuke-CToXgiapan,Qno-Test rpo,anagawah aithmHoalۃ!Ni>Backnd:*OwѰm ole:qc oc__YbiXemmeaѩjτOsahefo8gainaarggf%ordassѮbophy(logyOaon.τo70(ox)ugghyoPtprk0Fgeian7`,1ardiovascRdise-reX ?How`r,mdata availableIng2:) aimstudyjinvXig+ssocir޺bser0mߍrh؍`ma-maqcks (CIMT򫿃񾒂S.i>MedInR137onRcpsmok (61I76ez,Y64earsoscr32vclu wwMd߇N"qu@ifiusqaXw8LISAy`mphntc -spec(cPnoclonbodybiHB-modeltraXHgѹa 10-MHzn8ransducerwRess:(!follow130mHg2olblood@` (SBP3.0aol/LtHho1.33Giglyide4/figh-denQipoproteinholesterol, 0.12mol/Lfp(a)06ox7hCIMT.impleinearegressionnalysisvealedoegnificantlyXdositivexcorrelatwithge (r =(43, p <1SBP_Z28__X(log-)ρ˃'ρɇpecc.ɇPulti???djudor,ex,pidsglucoscontinuȉshowindepe(ntVIZAβO1OO)lthoughhmil؆esereduc,didotny؄`GA(
Conclu:2TeruP,watcarotaroscl1omparis+lnasymptom(cubjs.Pfngay阐ort!obtainatrs diffgenP `play byyalsosi8evancemeasuނraPce.

C-120ohggNoomAeouss:DL-apooppB (arp@number)oookJ.̍@o,Ö.app.YMeӍ arCQny,LC,׏pham,E xWNu>BackgroX:at`H(wl(ȕy)cHrbloohnsmoniap+ipiskbfutuBronary8(`seremne͂iabhmeBeaǍȦhemistlaboorieBecauseꉲohxecu@Bhlm9qSB%Xtotalu;&s)cirh.lpifugã0q8eqfroGpriowtNMRsrmmu@urbidi8rilPsssociBzwhiexXV(d1.006/mL8junouၲ(A`-T)woulQAqu@itXhiMsu>RpvxCaHa16oluoov@mHьik%ZĐpwohnt(alu(R1)  0(R2PrietaddR pck­㌓0bodSaincubRR13ank/htaken;an2@bsorbZqndpo (340mt 37°ResT"iZ#sHꋉHelfѭx13463003ol/L (69154g/dr 8u84ay20ib؃4.8%j5.4%(aSlimiJ{;01deti(LoDowthXtt×,117?✷on,Pȏ/d0%ׁ951arh5lxXsobv(yexix)der04Gh0-3900-2p-misC@p`Y΢9riplz,ʴ7nˆHsߗ,avBXɉXq: =0.92x + 7.6, = 5.+`ls绸roduc؃( oD8C)A.ossehepysiemi( lrDTAClu :טPescriaWuعOOr_ߩ(numberp b؁ーoautomjcist yz.uepd stp3argHssiznee0.phЄishhk!abilityoP3-08ndossesspecimentability,eagent,referencentervals.

C-121ojggElishtfracticalPocedureoreas`=totglyceridesysotopeilution/Gashromatography/M8ӈ tetrythesakaedC8erHealthciZPo (CRMLNipieaborry)GGGDu>I.oyamax/b/u>,.,̓iρ>2T.himah߁,مhikawNmur. SUniversjSuita,apan,߂߂߄߂߁,˃br)Ni>Background:!ԛ@e|riw (TG) (ol-blanke8/es)ntsanefi`comparinganufȁprs’*clinb~iehods c)opiccgx/t (RMP)CDC/Ktcaxm. heviouslyYsdMP*usɣ(GC-IDMS)gg`76substitutӉd$.eavlsoleɰsetpgHystem,purposeQmoaccȅTGndardizr.i>MSaAAtarf`eliminadris-HCluf8 (50mM,H7.4).liquohʂserum,(libs(2becain n( 1,3-3>C_`--ዸhydXyz动anolp ssium#x@ (EtOH/KOH)160߃0>C1Qllowevap9vacuuPThiduCYfreˆw iv֥𕠁idpyЍHdducriJȃ(nxthy(q1orgayᙰovPniggnzs(or-tymsAJpGCteII peAdeljhmoႲfragm/z 116b8rHpongqn`Y@p s,)فlusxsBQӊngResultTwou`poolHQ27,28)QwЅ(a;؁drup8!20runsata۠0dXlu hs`pp֥'nang@0-100mg/dL)j0.9999 ( (n=4)V>agۇssay«T0.22% - 1.77%0.7602%_YXpxihǀh-0.34X68i>ConclXon4h؊\s`s@icici";cyxrequiCb؏Ѝi RMP.H.dw ,pD.yat S.Lbl,ˀDobbin,.M.imberGaM M黯(2gatography-isotxorCh2009; 55(S6),85Abct]C-12poiggAp poteB/A1 9hk惸pke ߂߂߂uHahm
YȖ. Ewha׉nsnrsSchȋ Medneeoulorea,epuc ,0iBackgros:cpErknowg`)lir HonaryyXs evhXm`se-studieshatpoB/A1atioayeuperioroDLndȀ@cholesterolniscriminngoronaryryease)subjectromPnt!.owever,elYnship`tweenp7ojskesndefined.heo[ofhstudyapde؅ehetheriskyBedllsEheFlipidrofi8.

C-123(okggEsmal0low-QǣH (sd-C)??srary6(CAD)___\u>Aذgawa,.oshi2K.amat߁߁H.aury߁߃߁٨Ptoρσρ.armon烯烩Megǁŋhaefer.֑`s߁߅߁. אi>Denkaeiken.,Ltd.okyo,apan,PHtextute,tla,AiTufUnipS0MeinPBosto MIQ=Background:Ӡoook onҟubclx јhQbesugg9oiomarker^pruuX@h`hgenicar0Pcs.׆ ou0dem5betwaWWS*scl1edyPvaswX-rangiography (XRA3L8lsthodu@esp ,P-lud whonderw"cli in@S-modifymK,„pviouHWyxpcularizra0werxcluded.ÆhdefЇs 50%moهtss`an2luxm鈈en bdɎserumampxuyY`abo(murempɍ͒jaomqe 8ay.Ԅ (tributionfdLDL-CndtheripidarametersasomedetweenADasescontrolsywo-sided,npaiStudent’s-test.heddsatiooevelop⃯HnertilealysisCrel)nshippresencPfivariouiskacto,zyogisticg svalu@ngsignificaChi-squ0
C-125ogcAhҔhusympxsizepolyacrylamlab l0phohis///+M.ada, S.sui,.usachi. OkayamanisǔechoolHeal Sc ces,ρ,apan,0NBackground:Evaaȥjmaxsew-Qhote()1ao1hbaccu:.ķm0mYth0nt8րhnhBsH0UlcrifugB))wv (GGE),u(arpgneSspe۞)-xm"liqu`chromatophy (HPLC)pv9yppliop@@fx.oughGEmosqmmoqu!archaboortime-iug (roxie24ours) fmakȩael9XXmppr@Rmehdde/abo c Xet9Ɇj`Aims-Qnon-.?:(NPAt(i{%'tadvhpHزsicy2?expl@d΄YɴCqzrPzdia(щ70inдM:irst,P7yp!NWV@Հbuffp Æ񂁅runnT[He,~y$hu(looa)(HыPT1.ƍq(hoerumrinuoh6 10/GLlum8c(B؂ȅxз!Hzyʻ0.ResȌȖ3;v ABdb`yvar,rch@ric򂉎ͧ;wefolXAmqeoh3.5%E@D-pe (120 2m,TTO)pHa%sf 0.375MԆ-HCl (pH 8.8ЄZg/bi((5%C(0.070ipxodifM0.1%eYyl*x8 (10 μL/well`:Ԇx3Ҕ&mix}SudBl (Ј8Mly620HucA.ŧwrh 75V10p126`@2=92M98fQǃRzKIeʎftw(NIH).kӲducimprecisyvalucoeyiCV)h 1.24% (n=5{betw0CV.38,5Cisؘπbta=cor@ithhoseyhePLC (r=0.777,=45).oignificantifferenceasbservedetweenDLzesetermin NPAGEnd~,udgStudent’s-test (26.07±1.41ms. 25.68 ±0.80C,112gtlyorrelatwithDL-cholerols568<0.01) riglyceridHlevelsq-541),(nsi*results@porpreviously.ntrast,igrationsta`agarogellectrophois,hichsainaxc)$lipoproteinarticleharge,howXn-A '103IH826|,ndting@obility!_Xxse0tiveo.
C-126ohggValidofewmmunoturbidirassaysrapoWAI:Bu>J8oher,..ȋHH.1toiMhe ardsmpany,̣!WhaXME, '"BBV,ɀ)RLp(axYmeasuremfٛIthnumbaroge icircu3re1inasyrecoȈpÂoi*)c8iovasrp؁Hdiagnoorder oporIapʋ`XweaxdopIqu>MsIRBCv3t 뺈a16olunte(@ooviHY(.¡Ywoat plu(R9`rumغqSa\ub_R1lankwqaken;n2BdQflbbtndpoi34t 37°8R;Fԋ)c,pihXthreHQC (79, 96158g/dL2.4%, 3.50.9Pp0lo3a"6ab)limi҅(LiA1+tyXpD@sщnj╨ir Ɔ܃zqutQde頻!oc320%a3eLHar(yg؁YobHv(y#exx)7#ЌxTjUF0-800Pr8ur졲hplte>]RocIhgۅ,ɱl`e(: =1.00x + 17.3= 0.94:i0Ixpl+!yтp c yaI-j, (C(hem10; 56 (Suppl);185ˁȈn -7%3DCpidizPrLSPpWegs i,@*u/4ҡº`-0iguؐhich׌׌׌׌ьH3.08.3115,364Ϥ803.1ϤϤϤϤϟ(oDBK3OlGGGFHG53GGGGGGGœOWT3x -ُoook嫈cte e0;il >ꄝnoخ seHBolysiHlipemia,騰rurDTAZCloni:descrireliablendccuratemmunoturbidimetricssaysorpoAIndQB.urthertudiesreeededoessethodomparisonithargampleize,eagentability,ʁcertifyracefalib8ors9internationalxferenceHrials.

C-127ojggUswheboyportknowledge9lipid-lowngut-p苰romys:emia-reldextm1u>S..an1,.΂e2؃؀Li߁߁3߁߁H.iang߁߃߁ʃǁLJoǃ0ׁׁׁ׉F.u߁߁4߁>. D^LMedicine,China-Japanrdshipospital,eij,ÁQ,wwwww_YCardiologypTGeonstituGlobHHealthE;jBiotiPcs,ek9UniversYSchoolPubl br)Mackground:ԣQrofiipesthaHXofterdЪgPde miskor@hexisease.Hhaveeshownbeo0inwhsomeohplikelo3aatt@`rokehusbylock``(velr(nhP`(aoscl0is).uimsPtigсuț?ٯ JngHfy8tTwqdegre ^mas8wwt.7M*s:i508i,elec*arad0II-Aenerh2quqBaixonnairahr d3`BreviewHʵ[wdbmu.stud4314mul inclusriG𿨀uttrea vcomplcecoesults:Osubj890.2% (458/)(adsously;we,n47.4240tookrugpc9obdoc('sespJhn鄫ӆ"nYl"h㊡{apy(lȢX26112/)㑐9Xcvascular+classif,jlPn 37.160aq"diffpeophH at'381whoБԇ_, 71.7!73/cogn˂!98376ansї߁; 60.9q32wvxvalX(0+ulN246OR'' 35b87/)ch8ggoal252.0y28ڎH񛿛Go:M?uggts.ț=dys`aoscknew$GvH2ǰaoo\ʷinJ3߫ӽ!depbtf@አsiytuiwa*c؃currsitu.

C- @ohggPotiRoAdipct(DyopR𶨇plicyndQypXiabeticPobevson-j)u>P..abla1,ӂhas2MBnagarʁtarjee'. 1ㆰurynd3eadsworldi@largenumberqXHicubjects.beseype 2OMellitus (DM)atisreracter0dyncrea(indipoissuasAnxducˁojexhibi0varioanti-inflammatoa8rogen@xperqdxevJinsulxresance.Ԉstuwaslann@tolucidatPrelxonship2llon-o-2s(simitavaila.7Methods:iftye?=wektwH0boȋdex (BMI)tdycro8BormsxlldividinpthreepXiz.owȂ0HYHighMI ()<19, 19-25>Xkg/m|2`~ py.onsmhurswichLISAechniqupStsalyHerusSPSSoftwAvers-12OetHWe桱 15 %owQ, 35%(х50%]C n6ꂉ(2.73 µU/mlpGA(15.29`Ё`imX[P' l`ignifhin1hor (p=0.041+weeĄߛWonÂ˅`brȄEHDL-C (r= +0.67,𔩄N B,riglycd-0.135)waircumfXu55WPhavhowaRnggԋ߇hY0 1nephy07#rn׀23)W?Youtnclon:observ۴gڎxS lipiofil@o8re(itThu0)atxmayam0ika*q'm.Cx9؉ohggSxq@Bpopo`teE4)biolog*samplcimmunoayPzYJ.orter, pVam,..cPnP,Ӂ.Htzgerald. Rpoxbor!h,rum8,n2KdomH/i$oBacknA?: (Eؑ迩БZ8i8虢ft︀rocesssup9[gHet8lisPcwthaularho@oltiliz8Zreg8neuroTpairJEopei)-ε2,Ux)t4,"rminقmajonapyd3F(sixhenotypeHumz43wroǎ4.ǛHUBssoc8mbamXX- e0spdhAlzmer’s0s AD),icc 8H n 9؅ADぐ hpbk{iskcADdiSs tud ۤYqgȂ˄cardiovasc"Xab0tymulticlhou0HsceptiRXv#We`RdopmQV"9s//ϧϢ3wiЋX iagn"OORYiAx`/ne`d)y>X#ksHd-ph!wɀcaptu`mX oyzaᣀv14ӔAxndwIcheuePp_ysmployedorheetection.ԀxassayasppliHtoBsemi-automatEvidencenvestigatanalysercsystemncorpors[oftwareprocess,etdrchivataened.
C-130ohggN-homocyinyl!apolipo Ieffnpxid@bilсHDLu>Y.sami,.umx,.˓HharhMHozuka. TokyoeDXXUnrs(X),apan,4C-131ohggStommuyipiduacontrol0thao8u>C..appe,.̉oHjH.Itop Metardsmpany,LC,׌8ham,E, MethodsIn0udy 1,*two-levelCÜdXyn0pen-v9芋sstoragt 2°C8@[perceҌȟ`oid̈Q0. de!c(d9CLSIP25-Ael AmaximPallow"c8Zfs ≤10%.Ƣh2,Gk53-Ppo فayq16 eshaampPYpliclowoo׍0mhe𫸋RocXInteg400,eckAAU 68Co50DxC 8nmmAܕBly OrPÇliagnosticsis 5,1S),ԙ`.RBP𠘀in9HsIweobtAdll.img/dR˧7showexcep,WrefXiQtoo:lt 60ysb\Wy/hlsoWcellqpreci*e(±DSL1fȅ>105.9 p5.102.8q2.4, 97.0k7{1073.3iy$,$,lXpectly0imilarl,'166.65, 75pj8,ф1.9701.3,WRMWZ`2''''b636.p153ӄ142.2ۀj69[4.xׇwhi5UC1c01284䂰B18.58GӭXJFa03`,b/<ڤ8HЗisgd|Ҙbecaus0ҁmadon wpsexg{ρˇ!mhaly0Se.

C-132ojggInvPigHgeneXa1diHapscuv hy0lyemsmokersu>K.otaška,ʀP,ˀrcjR.rusaxi>DetmI~贀mistrPaxb2da8if,hUnrs ,NHospitMotol,Xaguzechepub, C-133PpohggSerumIi-oxy8LDLbod nepalecl؉subj@su>R.htha,.yawali,..adav,̀hhl,ʁarmaJha. IntutZMٝ8,ribhuvanni!itypHospitKathdu,, homesystem.׀nasy/aeږWRdise(CVD)irfe.ȅaѨxfeatuσȆAbnolisaveeY10thyi૸cli@ȯ6,9Î8KA!-cess.ϖXzivo(8hosoj.e8PAlur8ФB]Low𔠊o (hWRinc(ǜmput/_tfu"coa0ssϟσwqhnotoPye>(tu@YdgnPѺw⚈s__ȓx(ox9A)w@0ds:ԚpX5471individualmeɏweek32±3.0b26.423whi41ildϚ13{SixQtchxtXselag\whoiȀobtricsPD:ȃyte-nack-uppzyhealthf0voluୀ 21-35XaYXoecruY.f8xAualano HConsusӈȻ9ar onloo`@`Txytch(TC),DL-di(tglycdTgY.C/1non-7Y:DSPSSwhowesultXdys˝ (p<0.05MqfTC g,ۋ#C/Ҙτ6.03±0.97mol/L, 646.41.0h92055.728.85/vP.565, 2a3910a7@1.3J36B22.38Ü;*4.80.50z5Xc†k190.886.95I߂)pAyoXiydiffтPw<sYbet`8IOOn-*ast,=2ȗ36L9?16)ϐϒ48)7ly A nd`QRecerϣțЙCVsROC)urve,loty(؂Adiagnofiy'7jH1095%I.01Ѓd8(h:cut-offoia8.01X1Xviq!0Antibodiesoiagnosereeclampsiaasespectively 90%nd 85%,ithosi逺negaj0dialuef 84.491.07%ׂ.
C-1340PohggDQopm(RValidponхLC-MS/MSssayQuit6Uaryro gl@ins. u>A..ueke,..aenger8i>Mayo0inicocx,_,N,i NIntrodu(q9_Y (PG)thboxan@apʍmxvyclooxygenpathw(abroadP(PIologyovasculas9IsoXPG-likompoundsbyf(aal-catalyzpoxpachidoacid (AA)depe(//-thu vidٍYvivo2ess`lip0@?h“0st0s”.echanistA;aeronAAhile}iHiqЁБЀXphos PV`omodtcurexmhuXlubsets,hughѦs- itypmaajissue.eescriaqucatographemssɀet(U)0‹qť11-dehydro-e<0><>2-P (8-h-`ےplle`*/aspixJons@p`~@asOMiHÃowsZiTurboft%9)0@pguinvolvQ˒O؄sQe(pH 2.0Jn蟡d ((deuIumbdS,0nch(= 25g/mL)#ddquo0a 96eHTenilЌӵmplpwcuXhcollفenj45 μLHكutos"rretbOMAXixed-!exumn (0.5 50m).Ƅoweluwithanol/0.1%ʱ׬furȦphsepz`yWhXbridge,180v1h,1mm, 60°C)saț77'&O/MeOH繡Y6n8ˇammxs" qr.teg;MRMeBciexPI00ͭ@xm/z 367/161,J305,X/''''715H309 (dwwt4ww>-?ρτ?ϫ~1y.Щ//a77>bߍڒ݌ɉj53/193 (Ce?3597 ();5 bhi_Tot stP1#h`dxa 3ȀndhRasst`r.Results:iuညsQenearitytween 0 -pf210,Q2à2g.cept0.@3,2j9999I--ayV6-8z10%苸PS8v1863on31??eterminednheowestevelativerineampleun (n= 40).ecoveryfpikeHtoׁwasith15%aexpectforllreenalytes. Conclusion:eadop胐ensiQ,recisHandapidC-MS/MSssayoeasura11-dTxB2,GF2a8-iso-hichsuitablargcastudiesvolvingbroa)n0pcardiovascunt0

C-135ojggRelonshipetweenRIB1e17321515olymorphismstype 2iaȆxmellituanoityromorrnÎaL.i1S..an20uY.iaȃgׁ׃ׁׁ.iρρρ,ӉWǁǁǁǁ`iX׉/i>DepartmLaboratoMedic0,PUMCo(tal,eijp,0慐灘σσσɃ -Jap8Friend __ZZbr)MBackground:sle-nucleotide70 (SNP)sКocia!arp(8yipoprotecholerol0///(riglycers (TG)؉Hq.ԅffnrCpxc(T2DM)z.u i@weت0essz=ɍXQ)NPplayids?:koloI``erac@ssomeグsiciskxor‡ᆹwwrNw0thods:enosAW_Jjzby+shaXre-rriCfragzlengߔ0PCR-RFLXq48nr@healthydividuals, 98?`gnosXx76̌mbdHrHxrtse (CHD)ɐ5lBhemoglo81c(Hb0),rumglucІed?esult8Ne0frequenc뤈eY玿stXstilyrqamo؊e,h+8itЛ8PY>0.05|5AA,G,GC0.,85009349,sp(i y; ‚olbV40S9nognifЇxc)wwhoBu broad (χoo76=3.543,=71I㘡bp,GO8,car wv(AAlNo=d`Qwϊύf.ogrgHsBsshowʑ鮲hr3(OR=2.212, .04'CxlPon:R7,uXE7._mayيv///// p@t="10pt"(dth="a>C-136ohggDvtowardȗoproteisixopuhssayrDL-chopol0aɻ,apH.ugiuchi1>Hu>Thw<fontize="2">3,.shitsuka<<2Mrikur. 1solubilizÁgBB`eliminÀnzymق"XBDxXixpnimHx7CE09phospOinhibiOFLp-XfromҌo"analyzusiqփ{fSJki1.006-063g/Lyidےˀ󑸧o؁Ж(idirevp8h/ (gelilPLCesultAo(correpYexetweeooWgg (axagce: -0.4290165mol/H2SD: 0.371840̓0I773xceptp,neg(vebiaspx??magnitudełcRalo0B.ǎ׍ysreve8qA ?M8la m;ҖZ0hzQalmostarrd86Ĕ9C߈߈ߢg,X 0WQlerspondi ebabXduensufA`le"x0du3firiŒآHҁepoye XYrast3BFʇIwhՠςadd9ggdGGG7showɊda owriglycerid8iot ((PL+TG)/TCS)/#degre-0 I invarbOOO.ŕ?5/deʎo_7Ûl0on:׉YmyLχxsoМ-DL-CWWn-arё؞ MsiHmpsAorderavonfJcliHsett8(i``@rtaؑjogheؽp0cippchaɕXsp"ڎuwh[b.

C-139xohggTY"prihremnٗoPtehflasma3TG@selow 15 g/dLooolu>K. Nakajima1,.΂no,.okitgamine.atsuzuk2Shimomur,an3>. Gunmaniversity,aebashi,apan,HidxospxlxsakׇׂׂׂpׁׂK(wautritionyo!brȀ)Mackground:emnant-likeipoproteinarticles (RLP)aveeeneasuredyhoterolsLP-CorHDisksessment.pweX,BTGs`8otHark8detectheresencefostprandialinsnfastinglaithG lsxlow 150g/dL.Methods:erumm8stateererdhealth-checkpula,ardiovascriseorfaoadHXHTCpG,DL-XL9#copntr"salsYsame'Result Bshowognific lyighȂes,tabolicyndromem.ut-offalue (75erile)L_[nor8ty jn13l!1twn`tyif`ϓϓLb25ɛti(:ߍthaoxsubjpWh̓Gƒo,+requyd>=楉pb4.8%j`tQ(mo؇10%spply).C-140ؑohggEffф ezetxcompon"زc9end-0gin Tixo1Ypt20uKohtomi΁akanishatanȁ3Ta߁߁4߁>DepضrDȳMEndocringy,howan(rsi8SchopMedicokyo,Cȅ''&''DenkaeikCo.,td0񋘂fiochemistr////????9???monorapHn-ʪaserumyloid(SAA),ppotemai bѾˡspoRbyڈicl (ERSD)Wahods: 26ŀGreceivingemodialysis (HD)ereivenzetimibe (10g/d)or 6 - 8Heks.DL3aseparatedromxrumyinglerecipitationethodin,nCl2C-144ІohggCল(t(etnoQPhoȨolAdeXminbtypeQFriedewald’smulaihrTXgDžDžDžu>D..ǥ@s.̀@ira,..éouza. Diagnócamé8hDuquaxias,razil,>WednesdayM,u 27@a8؂b>Posteression:  2:00m - 4:3Q

Point-of-Careesting1D-01gG_^Under-matflasmareninesSTATЄׄAnalyzer:mpactnarboplonncademicncxCen.___\u>Z..eorgievskayaȀ/b/u>,҂Rger2C..chmot؂/. DepartmЍZathology,niversityospitalsHseedical|leveland,H,ooo)ooSeidmoGGGGGEIbr)Mackground:Cheherapeut@agXs,pecifly, frequHdosed|shiche(b)easuresxom1p@POC)8yPmsrutocistry0ssanufrsonЁtoDMS-traceableehdincȆPideP-"adev2haseenpo.heDA,SCOdCIssurecomdfcappQnsaximumFR125l/minsaimurrstudy((1)Ȇ:HxobloodÍюQi-y1rtl (o𧧂eisi9QVaߎ ()onczwithorHlowba,(2evalPpot8ihiьresulbБM:amplћpweobtadӁ`IcriHy.׎󃴂@aVzenzyIԅj؂g`subsc8rifugI؆džd%,=bOK8%clearYACl)cuCockroft-Ga.żˁhglomerrilr8eMod耘DietReXps (MDRD)+CalmBuBto`wlT€b(mg) = (targ`AUx + 25)]??JH/y2_\modela`n-AfrnJfe055weight 60kgh!5ХL$,儰HvsIPasXIXhpgQB-AltAsis.R:irty-threkoris$Xnq0.461.94g/dL0.200[.̆OLbetwIuڂt#llRbjfolKhipQlope092`tercept -06,tardrr`U144,wCoeffic0.92()Xni2.,ljbe@limixref0.6a9+thдsn=7(s3AH32 hBP]da'ѕH8c 45R(60cDA+capp38+XقA; -472bS.ɖ!q[75maximum&aߝہH߂oLJƈҏt1(8)͚3y112kr4t@nclonwwtdem`!yc:ѻKQ\n`x0func,8npundoggggY۳p7(dh,isifcoulda@enalunctionsingheSTATnalyzer.

D-02gb__OperaalharacteristicsfmniSureagi!fluidlphaicroglobulin-1estorete;ruptXfetmembranesu>P..olmu>,.̀alik,..ordash,́rMcCloskey,.Skle. JeffersUnivPityspis,hilade iapA, Background:ԍ774(AMG)sntendedoMGsarker (ROM)urpregnancy.ccu`eiagnosmaZhfultreatentsXophylicallygainpinf8ePweeporturvig:o1hu>Method:(VLLC,aidge,Aaut8vqle-ussposabletripmmunoassayڌXquivalcohnpo-of-caHVsZhCG (colloid-labelandwichay)pL,iympxswab,hZslut0opPxte(0.5L\quotYkit`lua."*)serr 10-1xbead9!ptroli.Г،ņoviIby@nufrхpHagly(iliz`P؂ tT 1sne;so8`@dit@CĈ2p':vi7ȄpЈ@cc8op9tru2؁0-# nْYٌaoHobloohplasm٘Y22%Ђ@albuQ.(BAS,ɕ@,orPsGA)epwei0Վ>(˄pct)΁\l_Zaf*0ans0ResultRG10g/mL)ámme8ςW]fIZb9Aoducne Pr;D23X!frig9freez6N^nealim8ڀب(ô5Dhs 1/3nʅ(h؎$.ɏdW Oo|8tp1/100!H0ρ̋7DOMrom4H(=45,0mIU/XM;weve/( um+=280'#aws*‚ǟk1omw*DžSq(low16.ȇnd)GW+׮othiV.easm caHitە?;170L,uthؘ //t t5g(0%*@!៻difencHetweeAOOic ҃pɉ ʰ'@han 50%ConclusqCuAstorHBҡ׀ۡg.ŝoɁoazj̈́sd.ar8g{y؈ װ𙏄ᅨlikYdus"|,sihwmanufactr'sscRzhi.
D-03g`__Evalu\;HemoCxHb Ms0illaHcompvenou!eu>L.ˍeyer,0ockenfuP..Ӯrach,€hapi>Mayolinic,ochester,n.(N,

2echHiaexiydnc7ii.ecoe (1a8t507?)difB(ev;gothisysigndrm8Xerremp0iᑉarvbetween/ous $)On`symtzanzidpo:spectrophoricO/)utomaxatologyalyzth?ally$aodiumalulf=ESULTMe(SD)Jul񪯌?a0.5 ±87/dL.|-82On17(34%)1625 (6wdNUڮXQ's;PiP37100'ǃǃ1.0ǃǃBǘcst0ardkvGh瀑collonxal,HdHtrnotpifhfP@ooob0vWt'ONCLUSIONGdoh3W_=ldסӝ}.owevgy (ROM)atgreraO ),chˋ numbfromǐljhyoȂpل(ayimihxfGprecieaPȆqneedYappea0olBp'".

D-048Xg`__NewOCT"BstK.usaba10u>,ͬo,Ԙxirokx2Yageyamρott߁߅߁߃̃oriāngׁׁׁׁ. ii߁ׁi>Departi)CȬÛistLaborayؓد,yushunis9HospitFuku,apan,QROHMo.,td0Kyoto_Background:`كߛMwísa(z,8mprP μTAS (MoBXS)(l30m,62Bt1A)ahpsktop\inu,smix)srannelhUnlikenxportedtheamecademiconference,analystReproducibilx:
P(OdwoADwȅnorȁgreg8,V 1.6% (n 4.8%,=5);high-0.988.aLinear6TpS cl1Hb|:a %13.1Hل󇯃Ʀiirmz"CoivA9À@0aetweenv(yH7700(x)H`؀@ Technologi8K: =0022 -0.224cgactor:X95 (n=101, a疸gpBLC-723G7"HPLCL,OSOHGG.008C1233[4.4mol/L2.720.5114Ddixhhysi csal WWu!wwupQ55旇???6:8.258???.987serum)nclu8n:avbfunda!hcteristicobtaPUnlikanyOCTems,wMop#us]lutomcHzer8ensp!eveR6sĺngAμL/0 vidtQOOfollonwhyHughtfulQagnos+@opfɔ(ȃp|setgs8exthng11ep(`Xowr鎹b.

D-05pg`__AnUrqStrXIdif8Qu`CheckCLINITEKdvantusA..ercH,.Ӏchul(`immerleSiealthcaD#JInc,:ReschDlop,lk(HIN, 1OIyЋObj)ves:Ҋs (___arrytowHNYS)`jewE(cki-sYidelr̛hߝfesalg igmeep1eeĘ:lPory,ؙ8coomvironjciofPe1perɛium-avolume)*s8.lˀe`XsшUϖydentifies theiemensrinetripypendmprovesorkflowyliminatingperatornterventionoelecte.nddithiseature,Hl-qualityheckhumiy-comisedkasQlIted.Նg\hess alobtain)accu0e"alys`testesultsexplfcaneadfalse.
D-06g`__N0lellularȞPglob`A1ctrol -@CommutabAcroPHPLC,ɀnoassa9do؇Aff8HMe dsׄׄׄu>K.ahu>,ǀ`.rzyzanowski,Ӡ0.igg JLech,׀`.yan. 88nc.,aista,E,1ӜR-®YthenlyellularontrolhichasntactBC.herefore,treck1ctestshentiressayrocedure.islsommutablcrossiffxntanalyzersflethodologiesmportance)alibratoempizedrderoprmon"cliniȁstrumHs.3Ultra''$2''0i>uA(Primuagnostic)/`wsXsiLjcHtionԁbaonLSIuide`Resultmean-94level-1ל~6±1%/5.8-6%׎771277111:Wo0](icsٓ,?:CValu4`2#oxXQq9NGSPendC wv@Ę ntٜdthre)'؃ Ddž0.0.שzUniYcop clearlyhows,xPp.doo@!@nߋon`G9clus:77\r⓿j)IFCCr1erm__ c0bJahoc҃varioH FurmgSZn _ ,huY8ces 1.ennettM,uoͯ C.b‹cning1dcTy2<@ym c`view.<d 2007; 24: 333-343 2.acksBruDEoldqMac eKhcDodʆ Parr8M“1labora@xɀ銸Ml`u`CHPem2; 48: 436-472 3al.umpstartϑ͂Labews10;ol 36,ovemb1/peight="10pt"dth="a>D-07(Hg`__TranscutaneBilirubisStud :k֩pDrHrE`L.iXam hHoll, K.ŕlick. UOKealScitr,klahomaityx.НSSummary/td)@WW>y 12ς1emnҋҁ''$Cyρ߂lope߁߁߁߁߁y-IaR7ǁǁǁnjLdţ!'vR/y65ǁǁǁǁǁallρρρρρ0.99ׁׁׁׁׁѬoׁׁׁ׃78ׁׁׁׁ׃ύ{č ">7ǁǁǁǍρρρρψy0ׁׁׁ׌56ׁׁׁׁ׍샧ׁׁׁׅt7ύ&>74ǁǁǁǁǍρρρρϛ0ׁׁׁׁׁ4ׁׁׁׁׁ6/ׁׁׁ׍OϩϩϹ{4ǁǁǁǍρρρρϛOׁׁׁ׌%Wׁׁׁשρׁׁׁׁׅr2׍ooooǁǁǁǁǍρρρύׁׁׁׁ-ȷ߁߁߁ߍ8ׁׁׁ׍ߛߍ/yǁǁǁǁÁ8ht߁߁߁߁ߩ܅oׁׁׁׁ՝ׁheight="0pt"idth="0pt">0.73

2ǁǁǁǁdarkׁׁׁׁ׈0ׁׁׁׁ׌+5ׁׁׁׁ85ׁׁׁׁׅs2wooooǁǁǁǁǍׁׁׁ׈1ׁׁׁכ5W߁߁߁ߍׁׁׁׅ}9׍/table>D-0bh8g__Mainaboratory(.ointfareyestingnhemergencyepartment:mpacnatilowndeanfulse.u>R.osecrans,.ohnal,.ills,̀PatejaZDeVineZRadzisky. NorthShoUniversityealystem,vhton,L, ED"0staffby9ponnelho respisayA ult8p؉`.tBo`ʁsavianeum0cubД om.’slectronmed@lcorhwdYmprespreviewura 2-we0xiodTreehieltch /tnesbrea8weakц3 AbbottStBcЍ(CPTde 80048)bbdaaio Tri@1hdia@ (I,KMB,JBNP)aeckmxDxC 600肠iomzABL 835҂Acc02Ҕ񅑞 rnazimpromlacफq2036nu, ly,4rWU16-du+tlМdi00ooadmiss(81ȃB97databe!col8submitq7yguidels(8yeet;we,decimakPikPqXsQPgnecdoP 7promdemȍmvHmux;bXeek?vED,hy(pledost7toncloneflowoughvXXayxar@qualitssuU hetmehkecc@jBgnif`pac4cr`pha.:


R.olziuu>,.uske,.ahn,.ettau,.teinmeyer,xlomian. Draegerwerkg &o.GaA,uebeck,ermany, Background:ԇ߇licitndlcj'"epresentsovelrocedure ensicZmedicappjs.rä@ugTestM`oєPuxd!videwo_X`loluntaryasifirHC dsi@byax0ځzecoXǁDCDזזזז׃+jC-hGC-MSxPLYqcain`opis,nnabino,enzodiazep8*WmajPabolȚ esult|Bas1ϊpaliࣘivitiTfAy(se ){cul(dDycutPonc`٤vice:Hhydl (5g/ml),or((20sam (1wmp0Ґ-rang70%99%94},9ly.PVP@m 888u>clPonh̗"inQt0urelibYoؿ??g9urHxiXhygic,esv0𛰒xni@e/border="1"gn="top"rspa5wpeight="0pt"idthdDer">CeJ/td)pGGG>lSǂ O ρρρρρɚ@ϊW{ԊG0ρρρρρɟ@ρρρρρɡρρρρσljljǂx삟*7gρρρφ+ρρρρ4ρρρρρωz󂟁b1gρρρϏρρρρϋρρρρ5ω|benzodiazep𓷂////oρρρωρρρρωρρρρω="0pt"idth=b>methadon

D-11Hh8g__Implementingeartiseasecreenus1aointfareholesterolssaynd!lthiskessnhemerican\ociati(AHA)΀jal “Goedoro0”aya8  u>F..aDuca,.ą(,.ʅweinBrock,yEvans. Polyechnologyyms,ndianapoliqN,a>D-12gc__Acceptaaewtii-STAT®HrtgaAhiExamppCO2.u>V..ENTA1,.YERx,.PINGARN3YHEׁׁׅא`SIRAIRGINIAEACHERALOTAL, A,ǃǃlj1ǃǁHEALTHCARE,ORFOLKςςςˊςςςm?>?9ABgrd:Up0eip2alATs,Laat@@uXurǦ9erXИ ea`Bتx(`in@changeLiv0eam(eethods:كћapsde(mPdy[iaoЉgga (G3+,CG4)8+,levs)vvh폀hs .aOcri "at$+/- 5mmHgBadopted.eviou8;0mHitudius''sstimatedhatorCO2aluesetween 30-75mmHg8eaximumtandardeviationas 2.2Y.onsequently,pair-Testnumberftixpecimenso(ssyochievow= 0.95calculjsettinglpha=0.05acteffect (diHrence) =,s (s)=8;,analysisterminxn= 5.i`ainrallelPdithtwoinutZold"ewotcartridges.T1bserv ecsMinitab® (Ver 16,nc.)qtistioftwaIzzPdescriptQs,pabilitydexea/lraphicepres.
D-13g`__C-E J%E`pHaeoluctMnloodǀoxPoCoc0hMis.OOOLu>G.͜reed,.ʪx,ҀZBei>Guy'X(StompFouHospitNHSrust,ondon,nKhdom,xi8tNIntrod`لMark1W7pcoi !eIllnesPTrauPRurypsulfrom⊚loqid sc, transfB,`ap`pHapyИyahydЛڅ竤utsidIexnufaprer’8ifi02haQPOC|gtesystems.סÝGocAccu-ChekniI,ovaSPp"AbbottXPӞi *re݃cobb221xmethodolog`ine8PdaoustitБ >Зɑ> hePiniYvenqobtX99$sithaematocritaluesutsideheanufacturerpecifiedimits.llamplwerenalysusingPOCevic andefPnceobas221ethodology
ResulHae18.64 ±5.16 (belows)lucos9hntration:?1.g7.8 +I 2.77mol/l% (,2 8.142.8Accu-CheknformI (positivei0.3p19) 3g807W5=NovatatStrip (2σ6> 4gQ2W3.1VMedisenhPXP' 4' 5oo 72.52h35 (aboXwWogggg;563.24ono313.06ocucgbnegHE-0.55OoW?Q7477?g 0W 2??8ǔ҃iClon11systemspmons)aO:withlevhׁfdecreaot.lAltȤi0howPslard{derior.hwouldotreKirenhBlinicalhtmay`r,utorequieffeceducSXxofponnelHp>D-14Hhg`__AssessmYNeonat(HybilirubinemiaGEMr40ToB]ssayu>S.ong,.chzbMxPhaus,.motzer. Unryospi8sÐQCeCe,H, D-15g`__A1tjAccuracdffhxRoaltosendepe(`CvACCU-CHECKG.ӗembrki__\10u>,..ietzen''$2''M.asmuss3Sheeld4>. iiׁi>UnisitAlberHospi,HB,Ùd` WashtonՃ,t.ouiMOiSharpBirch6oroBNewbornpSgoAσσiσρEndocXeeseaSpecialHcKay-DeeǃltakeÈ"UT,-NBackground:ƥHbbgddrmiة@ssxt(impont10ls('"valuc8resuunnecessAin(vx"mnor0lpbenePQrapy.eqdaa wHkio (MIChole/*ips@\ׁ׭ (BGM)plitsamplйJru9P2aȂc2LaatohhGadY؁϶\oj40mg/dL (2.2mmol/L0T3s agnosXen`iv s9JnhlculBц.*'MaЍh ologyip_e~KxmI盲>PeryarGBAviva4фtesOloiRd~/}| Ǒfrom򀈗Pliquoteproteinȃoȃchi 917xok@Y*7 7ϋ{631ԄBcolled,䢘K70excludPlysduo(riA)ducS,Xknownmporrorsang 23-65%Tab(summzHagiLxȓdisagtHoi`limt0mo(PpJ襀9recomhiISO 15197:2003.ՃGa#p< ,j1%Δن%&gclassSincoc(y ≈100%acutoff51F8Dۄooom.oCons–`urJliev1Y;thGli(y$׬hi``zɁcs*Κ̋imstUS. **Aystepdlop.΂8availzUS敖NFORMVIVARPER9iradrksk/@tder="1"ign="top"rdspa4wpt="0pt"pdthdDcer">SyÄr/td)σπooo8>Type[????Bmg/dL(mmol/L)seferencelucosenamples < 50g/dL(2.77mmol

Ratofias ./.Exceeding 15t;100)r% g򁣅GB/trhrojACCU-CHEKviva߂////)28- (1.6-5.6Ղ.30.12oooooo">0.0%׉PerformǂGGGGB11-359G6-19.g1.h07ooooooωωωπKnIOOOO251.0-8.g1.8hgggggg0.5lj/tablepa)1D-17ng__CriticalŅuationiPointICareloodvMetersthpaPenaAppropriycaemicontrollyllЃent.u>G.. ,..ox,ҀZBeale. Guy'sndthom FoundSHospitNHSrust,ondon,nited˫dom, Iduc uresY`hypergaso`nh\isHpsthAoutiab0T@assocXYween󃟃Qadvpute舠bobservxnumerous]ppsangIfrom?admitqto generwarwhohvexЅ myoc0ipinfar:2 2tudePairedestompatoeference221:ccu-CheknformI87NovaatStrip983,7714landltmannalysisxcobas-0.07 ±6 (limitsfgreem58 -44)105271332p6)Conclusion.AllOCloodlucosesystemsithinhevaluat@emonstrat0sisticygnifhcorrelQvmethodology.uT#/noׁdif>etweetݏю.heshowexcellmePbi`wh_ocrosseorkingange.edisen8acablutpcreasؐon.Ȃver;di tachlclin߅8woulprede(uȐxAGCotocols sythatcbea@aospitalett"implolpeight="10pt"dth="ap>D-18g`__VariabilityAdem p8 oie;zŖerureStepFlexx®.acZaц߄߄߄u>V.ENTA10u>,.YERw,.PINGARN3WANGׁׁׅćRAUBN>. S9RAIRGINIAEACHERALOxTAL, A,ǃǃNj!ǃǁHEALT`NORFOLK؂m?9AGackground:vGAsייייңicequ qpA0chꂍglycemiaayᰈc(oP coutXebei,amѝƝ,{by2Saraealx$tVBGHper!Bepessay0ndividuspsOعs:n(Sel#9325SA00023ifeS,ohnsЈـd)oyKo8u@onagҹsroml(Lot# 3053672003)Znty-PوWWSbta(venipunct8n-topub9SJvioexreлliɶiihusgsadjcC!{iY͂9,jw@ l9in؂ 20-450mg/dLydpdfourou`(B1:ҁ;2:41-73: 714: 181);obstHtorMtab® (Va16,nc.)xsssoftw}analyzBartlett'spe(e's70testhomoe,onferroni8qpihndardbھir 95%Igraphicresesults:SummaryohowthP ߃ޒd__[xZ (_8=0.6-1.6, (!1..8'` (g,4-4.4/ (<4a6.3.hils 12;3did׶@ignifhdirse s(P >0.05),' 34[8///-lcOOߎߙ/$visȄ(firmReϗ牲.urthermore,orroup3 (71-180mg/dL)heaphhowedat(isouldeevidinwoub s ( 0nd 120ithomogeneousariancesstimatbyartlett's:Levht0AP >0.05).Ɔ4 (181-45ralanmpredictable#bilityatternfstardation؅yingXtween 4.1k6.3)Bincreasavaluesglucoso1w@not恱.
D-19hg`__Cri alņiSieDiagnoc`CAantmpaaRefereHPLCechnologB@essHBA1ct88`P+0u>G.͎0reed. GuylStomFouHospitNHSrust,ondon,n Kdom,Rg>:Norm:GSPn 5.42 %D 0.06V%17,FCC36Xmmol/ S88R2.43.gg`Abnr;o 10.44u13t29wn 9 v,Y1.34,d49gkr2D-20؁g`_="0pt">Dynamicemperaturendumidityrofilesorssessingheuitabil9ofoint-of-Ca(TestIDur9EmergenciPDisasters

W..Ƃ(uson,Ҁ.ouie,N.u,Ӏ.umner,ǁKost. UCavis-LLNLchnolog)Cen,athyLabo0oryedicinUnivPXg1howبلތlNewrlea|hurr8neata,h = (c/a)*(max) x)=a+banges 2045Xlsiu, 396%.υrh-au-PPcHaH,2010arthke;¥ceh,ndonesi@af04su; Spfield,assach0ttԁmh!Janu,Y9_wtfellutsi\barт8whatm82Лnpȓ򋂩ycuQFDAicenclaimW>osxoӋr/navai{١ng.F{6iteamsAuldwЈaeff8Jux`ev0e.הXm@a)Ȇis?:PcX`t٪,)ulxKT),)Es`8S0xrtldcl)\0An ÊFacilQ_I/phmo8a>D-21gc__CraEvalu’ E qHyhraemia/|IBloGlucoXdrmrbyHi0HboiȺ.|u>G..reed,..ox,ҀZBealXGuy'tomasH HospiNHSr,̎@on,nXdˑHdom, ؉hENu>Intro uytbeyyh8bycillp{acroXc⁨cip{aqith@hlis):ώTcpxe1%&z' јX\dmis).nHhhho 2%Pbere deb0sb(stffaiKstUe؉xrkrcѢ80OO4.4p``iv t_1ekuryWCalsoCobvC߄9303ŬHQcu.9hyd0ulpoipHbzcircggQflh 0lea)yoedemSoloaln=_OJ8s9|gQygW3(tudyoc@A-ChInaI,ova8StrAbbotXPHўDanaly9pJref8IKco221xKydmournstitution.
Method. 52yponatraemiand 50erpatients (normalange 134 - 144mol/l)ereriticallyxalysedorholeloodlucosesingydomrteri#samples.llmonPOCystemsref8nc`obas221̀x[.odium Pn`iPP0mSgϊResults׊Ҋsubset (151.94 + 4.70imparis@toz:>ccuchekn)Ieani8= -0.17P0.29;imiofgreem#7!@40 2govatatStrip03!600.543edisenpPXP2378c28.951ރQ24838.ly.0Y3249.18735Cl0 ׃Low72exhibit0bGAwith(8tudybothe菸H XBlAltm^demons mini!scat"Dׄ,ichouldotre deir`eblacHxcrossόcippyealthcasector.owevduo2`kssoci^d@importaׁӫQs8ff0ivra)egimdertifHproceduЋXrequirPhup>D-22g`__DlopapidoitestNT-BNPaMagechHefti1FutDiys8sV,ijn,erqȃGGGGGPhilipsuba,indhovwwwwt`wwbioMerPx,0rcyry^P-of-(h) vitrohp(ȁyaumbreas:er Kt-to-result,rreliabPty.IHchnologynabld mmuno`aysatnXxpliHurPus]enpecarkՉ|Pٜi`i rail؇Y0,8nQshow縱colwxmpx@olyمzt_nekey!ґ&s)hpaon5Iuus1planex8hfilbddowmhuRwholelQa`e@ExP ӄ')\postridgڕZn 30Itot׀Ɂ6Oo؃ern Aautomsystemalyser GU!impanpOurwČ0KWPsa8(warou10g/mL) 1exampѦéIDAS (2Gͪ`"is3with(x)yЂ9B8oktLium@n ڜѐبs𣘃1.19 (95%Ih04Q1.34Ѓ`00ercepR147.5-6.56307.43)a? R=0.88verheange 20o 6518g/mL (n=65).
D-23ȏg`__Dexmin5LimiɊͅ5ATE-PCRPathogenICr8cXyɉ(is a8  u>W.oonlert1,..ǃile''''&,.Đier..ׂams 2J.zajkaH.eihRicׁׁׁ,҅ar8-BrownɇKos. P݆eԠC𠘗iTeach Resear0iUnisitPf liniaavis-LawreL9moNonalabooryЄ/*chnologyD,??:,C,A,77777ShsoPcEwX,D'''i''DepxBi,©dhWal0mͷBackground.ӱprepha쫰 9de9non-coaȱnsرqeniRapidiidf-p4sablapp@tcrobi`t0,m8imvkutcome Lar-af-P-expon!xpolymerIcha[(})`Ȗ1msymmecЮuizl)exc8ȁ(le-stdNhadvag1@DKc艠fa`rshaideH5 X`sP,HvailYtpَ.Ԁgowtoiej2[(LOD)tXwc (g0)._Medfrom 12ho8organismbt@ yAhnypeÉCollATCC)bexcyusamxț(tocolopph.luуAs diˊ(con0ang҇J07OO>-߁ǁ"opies/uL+9؏paI5!xjrolalsonjknWSǏ˘heiyptoȒ8voluțeGGassayas1n-10c0Im(arPe9dnothibrfe3whHHBbhum0Ɉ_[.dldem`pabsˌόbobȆfu (Fig)@Vif:Hpec(e.g.8i>EQccusȀumHHs!)Ygfluoxmeasd35°C55 GPncl.͐lj׉sB,09@fuiaalu{djuncowz[emhpcr Yl+ڽstudyvfxyZiachw evce-b8PciighBbedsЅN/p0pt΀aP>D-24hgight="0pt"idth=b>Objectiveeasurementfatiguesingalivaryeptides

J.alnxu>,.ichael. Hyperioniotechnology,nc.,anntonio,X, definit.yleadYcausaccPntsthn"outheorkplace.,anydividualsstrprofess(al(c0sonder-report-.ςr$т2interestmgpthroughzdrugs,leep,Zdie`rihtylehangescl`c set牕commfeatȌRllnxЋdiabetecaxrcardiovascular shTЄim0oelŠ blem7ggrPn $100BUS(BerqityYeven͉*orpiȆhowo8eff[lyaged,8thod ؂nee.METHODS:eyp`esizRlRmpos"]small-molecwteomexaY߉8huȁXcolЍfrom 8hyolu0enga10ur"kophys(70%ximum)perArossov8hign:employ wpe4stuщwoek SEach,a cipa9formc gramupplowPjs`Ѓbyh[reciy.takxbeȁx^y(iouimXafW(ppfiiIotaT8jn%wwwц__^tːshJLC/MS.ÃG2ZabwifȨɤ0deÏ@ubiomark0.ȇ@xsț MS(PPovoquer~pub[tynLIevaluȞin殰rȏفfragmpannfiRQnowp^ytokl#ELISAzanɞxQ,0߁ۈSpecorcp牀octctrؾhXxr:`a 5`failI9ESULTAplua'begin diȁysP(24.3±28.00Hr], 0.01828)?hr2orvtnBI:ՍN,phamyl(ɉ on-gamma,uqxfor-,noxhemotic|leu 1-ȃXimmunoglobuX(p<p0017iBperHicon(F,▹2Ģunil(Pro-Rih(PRP)ONCLUSION:ԫRtogюev suggesM?Fl`LoWsaбIZalexhav(outWsuc8supg_technologyo(npwhQd8H]1.

D-25`g`__LBiosensPo -of-CMႷu>Wx.lackburn,Wu,.ʉ8raOPTI(d lystempRoswell,A, 2D-26 @g`__VYdiagnoysta(؈21t؈0;sc$0By`ne"8cږKxponԻHloR omi1AssPЀxCL5(RATPAC)Pu>P..olxPHOO>1ON`/upS.ǔe_,āazׁ׃ׁ,rayׁׁ3ׁ>. Steorge'sospi,on,niK8,OOOOOSchfeal@yReAschhQeld׃׃׃׃Ոȃ׃ׁRoyInfirbEdinburg_ WI1duc.exroRripؖÜ}GG(POCT);a:i0cs??phpmg  idiffh֨xgexad{sy`k}H1/ʄ߇ʁJ83dZ8wh?_ba Plb8yCLT). P18prlCcuНpYdeHtJ(ED)6XriAPh0subosyndrome (ACSȍnrH( 1125׀ˆϒaѲ I (cTnI),yoglob0CK-MBad`90ins慰.pdلsam0s,MiߍޙG?Krmtilklocga tocnlyǁܞus1SusS (SiqsĘ6s؅(lychare xayDfows:tYlimit 0.02 µg/L,lge50 µg/L,nterassayV 4.3-5.1% (0.03o 0.22 µg/L).he 99thentilef􀠂isp07s.yoglobin:etectionimit 1#;nalyticalange 1-900inV 1.9-12.756308; 95%eferenceval,ales 2d,e19-@comPed 20-8.K-MB0.3''"-157700.15-1.293.7-39U7726-3.5AtindividusitcardiacroponinaseasurȀ`follows;iemenTnIltrah3)thD-27hg`__E8c2STspor˅bGlycosyldemA1cA1CNOWГhDiabeP݅u>W.am袯10u>,.˕n2DafXdar3Alsaeed߁baz߁߁4߁߁Fenz5Sjasse. C@eHMednHKSaud’AbdulaziznivHealSicRiyadhpirabia,)ppli __________]__De@t=Xhology &;aboory' ͣZHospPl߄߄߄߄߄ٔ߄߁7777577gggAlkharjerل??:Aݱ'Backgro:ԽY(Hb8xsong-mhsessgemXcrolpp`00ɸrecomdmano)aimthtudy*tovalu1QetWRflooJsphysHan’s ػapriycareliniccprlab-7Jerm4()PʴYow+Hosoh8PLC0alyzerwds:†weqac!inDTAubesrom 98onsecutiveatientsiagnosedreviouslyithype 2 betica1onHOriteria[noemoglobinaȂas firmbyGnlectrophoresis.mongQ, 54 (55%)ereemalend 44΀,canverag@ of 57.4±12.7earHVenHloodampl8Jcol`)imiateanalyzunoassay1CNow+ce (Bayer,SA)nhlinicransporAto#ralab946ours`t 4o = 0.965,=0.42)pos8gtiobserɌwe?dp<.00001؉meɌdardOJ7.6.8J8.0j5apX8C0IAConcluskPility'n#POCT ispt(fpriȀؖr".owe,X a/؉xsureiߋOW7. D-28pg`__AssessJAhEvaluOf¬bGlucQMoniixDAis!IL6´Pla7.'''#G.ˀpeyWWT1WW>,.uahׁך'ׁ׃Beecham3Sankw4F otchwa'%5''0u>C̎ӡшor8BueachHospital,ccra,hІPChemlaXlogy`thGMS____[`_____YgggiaUnrZjPdSchooWWWWTWWZildȼ:/t/y729eBackgry:Self/Hb gܩnmcon$treasplPdeteslHussWWWSMBG)avable,tePpaccuracKs.pPQstudyZarpperXذhu-checkdvagXOne@uchlh)ic(usmxraTAC 8utoly0 (rehod).WM86pnt0hyorkrrecruiI,adep44epp42lq0d 18!55earQrofhh$wasc strip l8inHyiirpecW9Test1*Ilȃ@5, 1 z5condsyߍ߁˄56;r-0.65 (2.77/y-inceptsჷuvers8ю׆1.022875:slope (m)alu995,18c91HRegs!lqustatpairy=55x0x +0.16ր87omproducibility (CV׍as 0%02.0%1.3%.
/É,ׂhtNCCLSriiazSMBG. 9Ȅbloodntser@8;fe8Y+/- 2/)labooryOhodwZTpȎi˂GC}aindtPha ymrovosХfthxҁ䘩itudy.

D-29g`__A8idnnI;k@ipeucHrds:a ex@i‡CHUiègeu>E.älier
,.Лin,.ussoHalengZChaphUnrs Hospit3,ՀBelgium, D-30g`__ManaZCosYXImpaȀlsHbA1cu>E.cCoy. TaǠrlospi,Ԁ,ƐD-318g`__CriEvalu Poi+C„GehЅReceivىAapy80M/D`rivvu>G..É`d,..ox,ҀZB@Guy'hStHomasHHospiNHSr(,ondon,ndˆdom, ZPs:pearmRankol,udAPST,ؕ1Altaysi?Ro> 1'𫾏G8.51 ± 4.`mmol/l,ρI2L2Nޡ8.49o"Zdɂ8648 2g' oo1:gg2 4'j'0.107 3gOMTѤwop8Ê'54O4??鄯ЄI001"0.24 (limiagre46 -48߅4 1 01/ 0.362727QConclusXo')(s󎠻ssignifhq׳yworkAge逩ﰤbloodlucoseoncentrationsnXseceivingreatmthattain,rreetabolisedo,altBlandltmannalysishowHexcellbias dinicattecroseorkrangeAccu-CheknmI,ithcepldƁbbottednPXP.ȅvthpdoesotxachlsflHcIignifXPwouldp ludeuse.airStTestem1nodifferebetweenOCystemre rapy/derivves.ԇsyfirmper2ovaatStrip ?? aadselyᇈcQbyreŔsolu.

D-32gb__App`HumidityrtefactesQsefulnpQual9Croln;PisHceProelf-MonitoraBloodluDevicewwwtu>M..˖ar1,.׋Yberg,O'no3R.avey߁߁4߁߁Godolskׁ,.edel߁߁5߁߃Cembrowski߂. UnrsyAlta,dPtoAB,ëdGGGGG(XHehcaCerWWWWQWWcineȣxwvatBHyviwwwwq@ww \rs?:Abr)Mackground:hoӃknown exmeeasoxmHatu`vari(-40C-+30C) hiit蹘baYonvironm(orshhlicqf- bgd@xpheno0avÅ jhintig. eڬϬϬϬme(H)Xsul~viousPdocu@?Methods:q(QC)7w0xfrom*:Ju2010*Januar12胈Py1Pureg(hospis.erkeLder<oog邰por!iwwwwmɒmisadȄUs miplag`8rageu=QCagst~߆OL稸:pxie15 -P91.da62643lowvalu]d$ustudy)iodzMvH2324.5C,uP&-20Co +@:pwHcorrelΈuܑό//wolevelmPd (Pn2+5mol/LAeakr0ׄЅobs0uLCELAiHHsȂpoP0OXxree7 (r2 = 88%, 72%44%)d9ip9ots;LG@ʄShassocȒ9i (p= 0.02<`0001Ccurʉ1Xo0angeGclc~8babrisГ:i0&di(re8I,y2ٕ ٌZummer;u r’ug8limi(Aacceptabiz9a9abroaH- 19%,part0auncamb:-i:thx* -infH0d^mentakesrroretectionuboptimal.ftrict8atisticalualityontrolimitsreoepplied,woeofvrangbasedeasonally(pendentvera9wouldrequired.

D-33gb__Aompari(9the-STATaolinndemochrMethods扨aPoint-of-CMhurem!hAvatHClottingime (ACT)nփousinVenuesu>K..lick. U2OKalthcitr,klahomaÍxK, aut tss0iʀ(epJIassar/IbtaimЙcurpreciȐRpondsemiӔ[.]lays9improvz{lC%Qs''"AipQۖΊJviXsdxcell2gaωwhich@ op*xϸϱ4_^CriEvalu덌EcRPaO2YBloodlucdmi4by+*oierЄG..ê0d,..ox,ҀZByZGuy'dtԷsHHospitNHSrust,̗x9UxKdomWWJu>IQduonG,1 ifrau0{@d`s,mayteOp@˃se.Ь%Ta(20,ulzir9)a(d8ns!2_c8gE⣚cyFӄP)norm؈؂Qfrom 10 -13Pa;vwhoRЦi⩰nd/9aovascular؟HPd1ti؁g!t1{Gelevن€`JIddQuoÊatu Thypoxicpd2dec2 i,ȬX nZar i[samp1obt(nt4רڀ򁨺<0//0uhYa0yx: (1).0QǓl c/׍nResultЂHe*d 6.5 - 9.8di؈etweenҔoethodologynd;
Conclusion.7AllOCTershiistudyemonstratnoignifica_GGor@-subsehinvestig.ԎWsrit0levalushowexcelllVaVacrossclinpectrumg1ȁaporoultre0deirseoW`p>12ρρI.rkׁׁׁׁ. Elos8uwon8a,publof,___ __AjounivitychoolMedicinჿ.Backgrou“D (hCD)”ystems`focuҝ(enresearch,yomplexᛡembeddPfluiorkX`rifugmi`M ,Iitowardkdevelop"h0viagnocs (IVD)1ghadapm aturiztechn ,ultiТsep0gb()angcjzo|()a!-to-answ8+772(SBAeBA ocesseXhobr8 oubtt≰adde 12fcpanel, 25iK)G/| qٷIisp,xnÕJcordoCLSIes.Mstra3__(lipiile)bon (c-:t2H r(TC),rigly` Gh-dIho0tein-HDL- r؉-fxanti`HSV񊎋G@EP 5-A2`6-AiHtplyqualIc؄materialsreandoxulti-sera (Irel)orlinicalhemistryndioRadiquikmmunoassaylusontrol (USSi.ethod(mparisontudiesithe胨laboratoalyzerBA-200FR (Toshiba,apanameters,Cobasodular170 (Ro,wissepermedsingerumplasmapecimenwhan coagtZl(iheQn.
2WednesdMxu27@؂b>PosSes  2:00m - 4:3QXa8 Proteins/EnzymesO>D-3g_XCetwlpha-1-Ax8pPɀqKiPhenotypeiAdhetricop9LJu>L..Ğto,.̀enkh.atzmanHR.nyh. Mayo×ZoɁHN, a>D-38gc__VdJLum0x-dƈaxpImmunoaDiagns,opu@Sening,PTPtmhonitor FriedreiAIau>C..roll1,..ag8,.akhׁׁ2ׁׁG.Ɋ0߁߁߁,ąn煏OgXbee. BiochemleneticsXboorxMayo×ic,ҁis N,ǃǃljAǃǁPRarieMBackground:hᕲ (FA)Autoso`Yessivi(sctapproxim1:50,opUS(!ogn(yog*[,ysarthraviI{8losmusceaknskXtȥormiH0rtrophpcardiomyohyaé0Xlmostwo-thirdz FI0symptomsyph؅X1015z.0ca҈XGAAxpanfirpi FXN9甈,heapa(ducit,|Hf4`{l*AlhNAmolecr.escribhpdevelopvnew,ethohathulPg7,. /8-؇m-augفtEs̈́*:MAPicrospI(pcoȁЃ8co7oclon`@i-Nqbodyiluhlo(WB)Ȋeluomx3mundysx (DBSzmixEIąߚThHf`owciadd,׍oly)J1por8osptavidhR-phycoery niHdd bjdˌLX2Xinuq 96-well8haAlib؄ycurH0Y76g/mL܄`yX@heasuspurifY!mbhum.֖@t8Pcr,v ,abilѠ@erfnaX#ЁRWBXA125 ul126ȳ41Aubj038קԁshr_>qs:xIvobseț`loXeHѧzspikxoo+PI.97-1.03(RwwtX?>D92-198 (N=6)æI<:220.5odxaassaV’12%X3(%Hco9#(3P5K34ϕȌQ 20)eR7 !5??=1?27???0851oooo3ooo16Q0U3WWW8WWWMeanecoveryfrataxinpikedt 3oncentionsnto 2BSndPWBamplesalyzondaysere 95%, 78(99%espectivelyorachte.ddialipids (upo 1000g/dL)rilirub2didotqerf!witexminbin.esultsj؆9-120%7-10orig`laluly.
D-39g`__Cellulosecetmembranel(rophocouQsensvellolilvertauHaprote ڂp:asip8 tdi0H)reinjuryR.ubota1HNakayamFacuXHealScceechnology,unkyoaku UnrToȏhapanȄWWVWWDiviɄ?ad,raduSchoolGGBOOOOOOOOOj_fæ5NephrbzRheuMفiDXsiig IepartmߗؙmarefurȄ??A WBackground:WWT(CAM)`vidoviewserumc( uxy!%6.haثviousxrepor1AMOOOMouter@ЂٌxnqLea1s,'InЃpstudHwm`e@fi`diffehtdiseas2[0tohfeaXkcorppondi;biopsypecis.Me`ds_Ԃ(Jclud(b1from 66''"typÆoi,̅IgAǀanheuily8lasmicbo(ANCA)-associ d ub8irst('y.wqw`zQsn#^hmmunx (IFE)a#odifymaj(bXeYwesultwsc8sifi3n&ba i; -glomlas (albuX-,Alb]ێsXTf]),kׁb-2-ro؀;βreol-biJ-$iRBP1mixFig`)//,Aoobv(61(92.4%)8V,Z2W(3.0I__^Z!lot75anydficwe ___ɤ:l*''h׆L՗y100Z85.7 WGM94.9Nρ4579y51CXlondžLjlltheistopathologicaleaturesfheorppondingen biopsypecimens.hus,AMlectrophoiss(itivendsefulpproachorZdiagnoSdiseases.
-40PoggNewӍficntibodixtommunoassayβT himizu(p//>1߃ށ`/u>,.taphiKomoriyaȔhomur؁AkmKohno߁߅߁. eiiOׁi>Nihonnr(y,arno,apan,i>・TProbeO.,LTD,anz1m)ޟBackground:Twohmark e (AD)reillaquneurofibrillaryangleaconstitue'"β-amyloidrote(X),hiXcanypqlyeyiearstagADxβcomposed42m0cidducbactiqβ"γcret񄢄Pdterioujbrtiss؜qsenmratthaggregooS'bGQh@toxЍ:ns;8oъ惇with8sheuc+pur닀studyȄdct߃߃߃߃߫putmts)i,nҰ ocloagh)ye(ds:AweddiKLVFFeptidGGG6-20ON)synqdOOGρρρρϒhout resulIܗ߂ZFor''''%c,'''''t 2g/mlluRprepxMXiQincubfP30YQ4 °C.ulbeccoZPBS@Yd,@ 10-fold8exces玿(ţot1637 Rpm׃׊Ϗ ׂ׋7'sameӵh߃眽`twomsBңSDS-PAGE,pDctrophsiioflavT (Tht)9itaaluye4bindamyloi`ur@2I`܁a60Oggggg(77777isuybserv atom ce0croscopyFM)%b??:alysxfirm(reaxouIweig熟/َᎿpveal Xtime-dependh+wwwww"2">16-20,ndecreasedorβ<1-42__>ith>16-2Oaddition.FMisuyonfirmthema1fligomericfibrillaς77774.enroceedioakeonoclonal`tibodiesdsse(ctivityspecificse?syLISAjwesternlotalysis.D-41hg`__FacilitXLabooryĄNlpha-1-trypsin yecyu>M..lliott-Jelfpww>P_\`/uD.ǀrenache//,/p N . ARUPo,altCX,T,UnivUtah/uBackgrQ:gg (AAT)]utosoȠdominsorderprxxphologrolIHtH"lungsromgradSneutrophilXtase)1hqeadgressxi!샎xi>SERPINA (]ˇPQbh 8polymorc,j#expڤTuousZvarixMansepben,sul2hnx)zfunmosmn-lle iM.πJqXdudJ`seidecco[ϏP/RzLhephcytqcaelliathlˆAdeZ*SǕul damag8ȅpcv0w.wy@svaluabW[c0plishxlgamimmunoassa0tYو8co8YechniquestudyEa alxphenotyp+۟pfocok(IFE)qyaHf0n gui@et7hx4lv.tab2nhblooalsossed._Methods:Յsabco9awoepIdQpendiuυJpٟXmpxbmaj /bservclinic8.ɏddi,ēQD-42g`__De``oPermaa0PolyyleGlycol (PEG)PpitNMa s耨ansؐ (mAST)7774u>D.aberg,.ʀonatoЁBaun. MayoÓxYFoun(,ҭ9s,N, MResid񑳄 (IRB #10-007098)!followchriy(bned: (i)QlaALT)alk؁(phospPӇ(,=120);؂ӂ 4!cHupmi(&OP>100/LhST/ 2.05WWV si)38v)ѣ*susp d0Xcia(4St 1z60 (12.5%ixar{ifug(15g, 5ins ąa501.roteGi)pXumnuT̬WS )qab-yme.ҌibynXarXsiXsʀPo8ySarJq`usisubQt5xZ_XImt@demonsqxra-CV's95.8%:0Jt211*293fwZ6.6s4.2ww2378a.ԍ`HB9qu51b3a)13.1%EG-ٌEPgZ14-1584r2+14rang7%).ubjyieldȃaa94]5ww84-99In 7f 8WWR,roteHGolumnsou697%9aitye43-86aP7702558//*14-41tenntrolConclusion:a pԔalyticclinjidat Pggestshat9=iXiasdetngxa˂'"cutoff>80%.

12L.Ƈis//7/.HQBindStBirmham,ndˀdoooo`ooDyImmuyzInf1IMedSchool0@fm,"brȀ)Mgg(C2chalaؙineSasehichmsrtcxsʛhwqf~ʝ.pQrixg,2 by4b,e1s (xMASP-nC2aBC2b.jHnC3Y0t<(knowsyHD †YonPsYult"sav먈-disIo@0a(ieiss芸as;ystemicupusrthyematxglomerulornephrvasculyQcf0p xiP 1eX0000-21eop mlsPbsur{iX*odiff2chniqu(RID),`0iagnos @8hno:8esad(Her`eHpoIȌqduRɰYȯ YA HP@strH w`pur(frombesrozij[IexaAX8ghy0i*xeSilYStSDSaWer@l?.u"er!+> (ohGroup)JBCAm(Pierceicordancithanur’s Ø)olycloiwgen`Q㏪q Z(po@ 6Еlib8urzrb/t.ԃ`star !svdߒYtrolluidll8lu[madye;yiboYpipetaiЛha 1/10v,fur#p1p8Is邀lh-tookinuxend-j91 - 36mg/L솄+,snyv<0.1e.Xtra-er-ۢc㊪Ɓthre3ѧ(2.1,Y33ccoef)fri5.6%4IPlow.12.2i-I1.5OhighMН1lWsɆkdeg`l؅xaexH譱 rqgXstρ<ؒ:Zبd:-=1.01x+00;2D-44gb__TQignnSubt8Abnormal((erumЋElXroph:ndsReflexhImmunofixӁooolu>M.hang,.i,.in. TempUnyyospital,hdelphiapA, ϐPo 565, 41(8.1%iBb,r8815.5' n.)'' 5sXױ(IgGmbda: 2IgAXsEf@hainDmea(@SEMu8lyr(om0s*(12ϓ̈GGG?ntifi__r1.78 ± 0.06:1.273P(p01xN9G=3ߍόs.ߌߌ܅Oeόd όψ//׌׌׈G׌0.61׀p7322׌p =cq)mHoglobul(56ߊ33thorlfGDy on7osOɉarXxt[ubtl nalitјWWWWWǹ oŅlRtlwhe˃One8Plowync!rd(imvicihy,level of βractionlevaRasriggereflexingoFEayencreased,orhichurthstudie8reeeded.

D-45gb__AnalyticalvaluӆextenerLateehydrogenssXAppl8BIAbbottRCHITECT icbSystemsu>F...an(Horst1,͂jS.osthumusOOOON,.ek8,.ampsink2YPemma߁߁3߁>. xׁ׀Diagnicent SSDZ,lft,lands,?????_`Hoofddorp''''"''''`Da@TX,rh)Nu>Background1:Ёmanderum왔d(LD)xvitysPds0eang(xdisorsu@hemoemia.wrec(lyhunchP✮77771ensuxatalignmhthIFCCerence`odimproveJlot-to-80ib4stabil.hhautzhconv`]pyru eeXminenzymPL,.g.FNAD+[tHЂLDف82P$,{oncomita maab`ba at 340madi8pory脸 LDǒsleׄeurind"6xuXCSLIP-10P9tocols.ɆPddi2wׄ΄0ыbtaiy Mologyꎩpi1paccX'.Ɣ⊨pool{sa@p`t 108, 578"1067/Leve)xrelkcun-markehKϊϊΆcarri(ou(͏.͖'eperm񐋄cA8000`iSystems oOؖvsoYPCg 2_>DutxSMKLuЛesssmpwhiH_[Results:B`Q,x//ggbelow 4.0 %አ}atra-)vidi vari48.6(jmeantOeئwjrequؔaGیǃeߊ׊ggggashow(n ) = 1.05xp-Q1,a 95(fider-7.4-0.66cep+8Ё:@7slh,8spiHyռʕSKMLwC/,ȕgo`agreoǟO??iPǣ3%@ngJiG}ClHon٤Y scharerisiMDNJ?

D-468Xg`__EcommPbĪutomhX1olucapillaryonelho P(CZE-HR)RQe_\SPE)u>J.. Émond, M..evesque,. È.ingras. UniversityfontréalospitHCent (CHUM) ,C,anada,
.ϹxsPldn8yiُmϔi4߭,ny@Zmi)xŃ ocloibhbfalPinvol(L'OOOOOOJ;tg(),敷[ׁ).deqledḡ d YptiQ(kBw໢lH
D-47g`__PAE,Hna8apil8yſeSys8|u>J..oisson10u>,٢Xedoriw,.ainsworth.ucker2Z.ddiǁ߁3߁߁C..cCuddeǂ. xiX׋i>UnivNHroao Helȑ,ΰwwwwwWebb@Cy8ert.ohna`b-Oakla,ar,Ii 灘777749UBackgroundiagn`adYhEp8XiohiPr`i00cu8ptificationndharacterizationfonoclonalroteins.apillarylectrophoresis:immunosubstyI(alsonownstypingrdisplacement)echniquesaveeclyecomeopuethodso@ndlencreasworkloabyetheanucesytwhichsegaro@gelTobjithstudyЄ0parew__Z[,bV8 (Hna,eaut,X),ith"CAPILLARYS2 (Sebi`USA).
D-48 g`__CbpiFluideakĥXH oluG`B@2-TransrHImmunofix u>C..cCudh1,..nior2Shworth3W.lira4Milhma,.ŔxrunsÉHP-Stable7GOGG. UnrpN9Ù achoofedneePt€Pa logy &;aboohpH0,C, 2UniversityfortharolinachoolMedicine,epartmeOtolaryngologyivisionRhin/Aller@SinusurgeryWReurosChapelill,C, <<|3-7(ospitals4VirginigggPathD-49gb__C~fwo Immunoturbidimetricethodsorheasurementflycatedemoglobin1c.

Ҟ:Ӆ:92 (:811.003) ;Ʌ}h,058n: -23q0,138qR19989.ge :ڋ*rder"al="top"rЀ">(td/t8߂߀튿Ɔ'2ςςςςς95 %P.jw''''#Pρρρρׁׁׁׁ̆89 -!3W7XρρρρρρρρρρɆ@=/>''%(1sb>showdep_ecQ.­cSnops__akccouoptimizۅs,(@reasanaly:rrorueXptm؅mxve(biosafetycl2һced1D-5b@g?_XHty`Fattycid-B0PehDwisػ 8outcmortafu0 okeׄׄׄu>K.akris`x/b/u>,.oniari 2L.panou.ialouׁׁOlezakI.apassotiri8Drpoulo. DeClinBiochem!@“KAT”erHospi,nGreece,ggg1ggOI͢inȄ///////)@///wwhemistry, “Aghiaop8”hildren’sospital,thens,reece,
+SD`fr75.279.yFy-two(42%)xdura(l-up!iof 1"_;g`betwi eJneurymptomhO3.2>1.58)oONCLUSIONEvfrom as0t'PtlyigQnon-vivomoildq*pڵsociqmaGdīw(@.J.uX/b@,.ǀrena //,2//>. ARUP̬?8Salt@CpT,Unis)0UtahehcCer/Backand:(ADA)rrsibx s\7il[`iaactivdQ9ton,PI(cHbrA\(c` essu suspect`tuberculousiЃԀ[8{@0lyӻytil8xlibe end-poX>W#lrefxmri@Ռ`,60 nireI،pYugPcuv8p)d8c؂1Z -th8ghpu`HyPmeth!deiObj:ԄGd*wwwvπ`؄ R͇scon2_OdwH0hpdecSabsorba265m.ҏ,`نmdispos96-wellltraviolet-Pnspaticroplatesealedithnltraviolet-Pnsparentilm,bsorbanceormalizto 1ma(length.heolarxtinctionoefficisfdenosinedesellAt0Michaelisnsta(Km)maximumeavelocity (V)Hreetermdglassicechniques.ccuracy,Par(,mprecis,alyticalnsitiv*Ienzymetabilat 4°C0ehfoachodyluiyperesiduampl2 ARUPaboratoriRefyinvalɇrom 120ubercul s-nega-1Z햹requirem,nDX75%0sЬxXowsGӞ@leous/peight="10pt"dth="a>D-53؊g`__LhrIte @fP hly9gZamodedietduc8non-hohoh`tldiseЄM.anop>,Ёki2Jcr߁߃߁߁,Ƞl-Zimax.oa, #D@WauchopeGGGGF. McM@UnᜠHamilX,N,anada776 77CjRerTsPIoPsabxtornenePspiЄkyToro,N'!)ݨ'Background:ƙswidȵun tributforBcryptogeirrhosԃ.Hology2elopaYot`llnstoog0l҂`u2ȁPthuinvigpath!eϼaGF/)(NAFLD).n0stuwDa?9ob WaratsgeXd@NulliH]ps=10)kmW:nlit cK12t萙6ha6emale pups.teaning (postnatalay 21),alendeZromachitterre8omlyssignedoontroietrighat(3ofgendp ).hewaselect#simulateXtypicwesn߁هz7,ekage,woGigge,negroup72fnecropsy.istology:XedyBruntcorsy mubsf2studyopionZσ΅)airxproteomicvalu+livsamples wei-9'ia-abinpad/*y,loodbcol$҄ҊhnAs (N=8PFa ysiccoisusdiff0nc9ly8hore0,methyhi0u8 2D-SDS-PAGEdexreavhbundaXo120000spot"x@cr8f9homoiz"(ID-54(g`__OXolinbDiagn1VITROS®׆ҲCRP (wr8)ssay???Tr,.howdary,ˀngie,ԐHuzzeo,̎0err`. Conc. (mg/L)

1.7ρρρρρ0.1ׁׁׁׁׁ7ׁׁׁׁׁ73.3ׁׁׁׁׁ230/trryWithinun %CVׂ''''.5ρρρρρ6ρρρρρˋǁρρρρ̉ρρρρ3.2ϋlab'''%4ρρρφgρρρρω4ρρρρρ˃ρρρυ\ߋ/table>D-5hb0g_XCriticalIupperformancehaHte@siNMDAorptissessʁ`acuisccroke߄߄߄u>K.ht؄Pn,..ambinova77476. PenntColleMedne,ershey,A,GGGGGK(esawLUnivit,ǃ f&Biomark (IS)helpydiagnos8rapidlyrep0pproptreat ,llowlinroutXtKiskIalpIs.NR2m聰oteoly⃰kdown]brasiPז,PeasednloodxeamucerelMaJcane!aXЋɋɕAyoalЂ` (1)?//-jϞʝ͉@/,ysɁH24hsymmnsetB(2ҪleveneurologshuKXulqdvdcimagM(SMRIЬdDWI/PWIitc T),]t؈ETHODS:hxTY52lipa(n=50,=102pn(ls)0indvega ayorlXuf0urer’sH(GoldotԂ,Îtech,nc.,tlhaAoз0r+laPde`dlotpibsorb(liHurv" 8frqeaXcknɅoRESULTHealthyivid`TvascularSohad߈߈beY0.250.4 µ, tlwhithr|mi3meH0.5Nsign!`xhС腟~alluroupANOVp<0.0001en؉ptywP98% Mh7Џutoffog/l9tv)(rb߷߷sb>=0.8)tween bleZ ( 200c)foundgONCLUSION:%biomarker forheiagnosisfShichanfferentiatecu0fromtrokeimics.ncreasedR2eptideevel> 0.5 µg/lfyatiXsith?qin 24symptonsetndorrelفfindingxneuroimagXudies.

D-56gb__PlasmaeuXphilDŽqin8-AssocdipocalX(NGAL)ÇBiomarker`Diabeticphathy___\u>S.im1,.wang,Ӄǁρ">2ρρH.eeρσρׁρρρρυ^Chunׁׁׁׁ׃Miρρρρ. UniversityUlsCollegeMedicin 8A递alÚHerxeoulo,epublof,I2PaikospitaInjeՅw/.,oywwpybr )Mackground:lal`aechlynducPh(bwhoseuggesPtubularjury.n, leauend-sta[dis,ypBch!kidneyXareracPdylomerulosclerrntudaepreswtteHodQfulneszpp (paߥdetecg) .Methods:Ԅ145e 2dmellitusw(murusflusammunoaylo҇Tr8et (𕘌SDiego,A).#vpdQo 3ppcurrbumexti`(UAEqst}filtrpP8e (eGFR)聈]camea0R#axypsm㖸QcoHSr@lsompdӍ_sult\subjsr`d 9154@nmpQ58ears (28-82k 0n 70.2 ± 30.83g/mL|OJsignifP  ׄs(a (67.0119.263r12ormowc, 81.3q55.02wicroi106.8rmavHi>Pi < 01dee'un8a68.427.69OJabove 60L//1.7(ߺ/ 72.935 15we30925r`̃ǒ(҃.urHif9!bHpryr =P460;ini""-(05// gCl8on݆fք뉡rThB smight1a|Q itoextiixir𳸆7eywHxI,yAD-57ȁgc__PSMatrixlaroteGas6 wjorte8d ׃׃׃E.ilmaz1A.ˎhuygun..zakp.emi߁߁3߁ߟu>F.rasǁ. ؁Бi>Maranr(yacPyPhcy,Biochemstryepartment,STANBUL,urkey, 2șЈRHgx(venouaT objxayA8f@iHy[(twA'! serum,lso)Їlev>pds:W(ollӐsamplfrom 42i`s (38lH4 le)Je䦨befo(irby-pasHXA@it߃܉Pșyolu0w'ұت`p.ÀupPۇnon-smokpeoxPooa(ȕ``t(CusYdrug7a(PXayyLISAit (Bia,uHia)/R&;DRimkvdPour8boorh dpairHTOjMann-WhitneyՁ?w!<0.05tak0pstPsHpignntWess:aa74\ʚG18.22±5.36MatdiffЩ8(P=0.61Pi((17.40±4.75LjWa/ (4.47g/mL,(n: 0Xax: 55fouoЅecrad$0hwmpɄmdždž7.62702.1357.99)W)clxo@qp ؆ՍwggZnoWh QrOOseѮNg@briefverview774GP.urҵwihvideBrPab(inmKJarg0opu rn/p>D-58xg`__Dopm!aephmecoJimPuresIgA2iP((essprim"iliAcirrhosiy???90Wph1Gȗȉlis//7/.. BindSiLtd,rgham,Ȁdˀdoooo`ooup>Divisonfnmunityndhfection,edicalchhool,niversYBirmingham,g`0tedˀdo
-1.oSpecif:tibodiradrecognSQcomponbut@(YDinАuopopꅡdXurbimetr{assaynSPALUSǔǔ™ϔ>alyqu@aŎ."aeriipsumb`w:R*(mg/L)1 - 60焧Sampdil0on߂/////10.ׂׄׄWWWשxτρrenivqGGGGG焯oolA:in77775DŽwwwwsLinetyy=1.163x-1.424R 2@= 0.997GoInpXis.%V (n=15_2.03%߅/>6фhst(ar1dhthpolyclofhncHur hfromumanilk‡p w P899%Xylx-dDS-PAGE3coiFde0(ybsorbaA280nmjBCANJ.#shd 49r (bloodo)a;Pdi5.77 (r0.65- 14ƒalso93@sxssing2`tig(PBCixrker,fir1hohology)lleܺDqtmyIYInfh,ni`y1B8hamK14.46e 1.252.20AshownoHxgnntlMann-Whitney<0.0001)levtЈpopulZ`weakrreDumɄXelses(Sp`coef耹 =0.347,ЀH6dataupporAHwesnlo9for 5}5-4s.ח{lude1t-ovidexapid:ӖЏ`8qufyh pmgXsl x!mo@orylpse.1'$D-59`g_XHأ soc0llaryoneictropho @(CZE-HR)ts:lc`us0uesu>J.. É(d,..̒Hsque,..ilbert,.ugré-BrissC etitclerc. /)MpHospitHC(HUM),Canada,hiwBackground:Ȋ(_\SPE)Hlowsn@*rn 8 fractionsndheirelativeuantificxon.ellustrateZE-HRlectrophoreticatterinifferentlin@lhologierpecIrotevaluwithevPabooryataestablis9bceforachf9 8؆DSPEg`gram.exds:histudyasonductednebiaaparys 2higsoluquyUdetyVbsorba1at 2000First,empgMxjrminspnormiisampl(n=95)sf(c=aragЉ׈sis,un`ay (Beckmaxoul@,biochemistpP`s8s.lpha-1-acidlyco$,ݕ0trypshaptoglob2-macru,RPo1mC3JC4GDnephelome;ransrturbidi"albu؀BCP.(\ >`mg/L{excluded.(ose0iuroneanaly.X,i2'pproyly 1,5earsost-΍,ing 8-monȎƒځؚad@ (20y)utLǁ€(limit|totic`(64 83/L)fslie±3SD)o塵נ42, 44%ale/56%eY,eAmediX(53s)eoothpnp (n-1)ceduhbeensbФ".

F.rasBezm-iemalӽVakıfǗbarahɾ8 Hospital,partCBiochemiy,STANBUL,urkeׅׅ׉ׁׅMaHran@rsqFlPhcy,WWZBackgroP:rowthit-S6 ()aIaAK-depen)fШmesangiIȟQa@layo8psvariousidnPdihsěقit mort㮵-gQn`]ɧcȰlea҂ςςse.i@aorldce@ix1eqblehatiabeticephropathyilllsoecomeajorssuenheuture.Ărenalseas0sndergnosedndtreatevenow,hPdetectionfearlytagessimpleroughoutineavailab0oratoryesg.ԂXmechanismᇯ,owr,@mainn胈tstood.centeri؂studY8m@modelsaspvealro8Gas6itcepxlprogressacutPcnglrulo:itis,߆߈laftj{.ecaucorrel weHwithidneyysfuneIto`aluY`tPuld sBrkfX__humaobvth@0sinvgiflasma#l^s3microalbuminuriay>is.
+10.1g/mL)Ĭoゟo186.6,ىԗ(wos__nW,(p03);om<(1)SpуGirMoreoB)/ /,i^5H77mȁww+tnclon:זټO0Tcli Jfuagnoredifutu?bbosen*itSqՂnotbn хPtH@0m )arlig_"gf`dyhaȃȁ0݅dopmClPzO.ɊedXur_PeQ)es

D-61g`__D?:ValidشunoassayIQu(i;PronuHI u>J.wy,.ra,gras-SchimPh. Mayo×ڸ|s,N, Rs:Zspecimh choic0asDTA bl1frig (7aysrrozH-20sup3eeze/thawP imit)quq4g/mLV19.2% (n=20)ldet9assayR1.2d:ritic)0.433ˍҁ+measurange4 1002</br>onclusionovelethodorNAuantitat!PngIFmagasystemasstablishednhistudy.hejintensitiesfent8eraasurbye|'$wereoi8yorrelattoсersetecقclassicalbandhow8goreproducibilit4canrovideothjfluorescencees,hichuldecisQreflpKhangeales’,useful mloizfgcliniciapdiagn evalu؀yutoimmune(se.

D-64gb__IOptimuCApplH=EGFR K-RASuDQpPmaWiCombinHUsPfҕrisEndonuclĈshmjDHPLC|u>z.81,.o2F.׃ǁׁ׃ǁׁQ.henׁׁׁׁ.haoׁׅwׁ.uρσρρH`G߁߁߁,؅r߁߅߁߁Wuiρσρ. Pek UnMedzColle Hospxl eij@, in؃Dp!eticsiohnologyApany(MBackground:baOIBl-b`p8ach@IZssess mnon-:e(lucercث`P>play portoluidYLX]-targ"rapy. cuy1Asigx~v(pXfic_r§B*eϭѦe(REDE).ޓpYs:_sseIxsc0BstNIABglIZhˊJwitypragsex19a21A412g13)*Њ8l܋-`aYvgabyi(darHubace.fterwTparaffin-embeddAissu120IaBKy-SXxponЀcequencь?cxsW ultPht(fourtA0.1%btha_sA1%.Cea揢r 2me!poSr2/fromNSC>LC,l27.5% ,16.712lRone 38.3%, 25.8 }/S??U) lyign'&(X߹o4.09;4.301,9< 057σσσσσσ8.4384.127׃Ѓ.ɇrisHwith,WTMSלW+d^bo8100m91.5996.46hoid twoڕ0%(111/X, KPa=0.702/-D676ǁƍ(76ljBhU:w83.15yp(105W.718Osist؅OwpHtu^y[5.34/4a
=0.851,P<0.05)and 90.2 %(46/ Kappa914ǁrespectively.
D-658g`__RapidfeisseriaonorrhoeaeromrinethryaghelHse-depen@ormamplو[jiserepa u>Y.ong1,.an,.uin߁߁2߁߁؅aׁׁׁׁB.emieux.ˉOׁׁׁp>. 0iX׋i>Biox8rp.everly,Aǂǂƈ(ǂǁVerbiltnrye1lÓer,ashville,NhqBackground:e (GC)qpahcasecoHmostequlporxuȡHransmitdises邹(S(es虀ȃmnei-of-c)(POnucleac8 ( riagnics,ompt8eatm( xvonHowR؃si؝s e9#olecularctOCecX@d7y:@quirSexsYinstru,t_]cedure.ɋXearch,aopwwssay (IsoAmp®NjW׋שҏ @bPdn練(HDA),߅聇hnihicponottߚs:s bfollow1~s: 0.5mLadd ea2cDtubuown5inu xtnchtop㒑ifug >10kpm)0ernata(Xa0.Tdilubuffer'!хυʃ#cloрh(95°C׆҄n-aga`?0ndi zirin.crolrosubjt 630 duc@bcBEStTM8f(a𧋄 as!mhmbl9Enzy؁LR*xlyophi777777/gc̄bdr*?yirT8Genes@BSPdui(GarXY)psultC]sorAGC"or"valux:ӜpcA,Hclu"(208`KkdiIyclinjlz)jexstud834#es)er(`hPX eimero2J~{stivnѦ(95FU50pY!two--m idpodeg zP58oБH5hꁔ53QOtOur鰓{vmakcavai ambiitematstorhhipórm`ONc.cctab8Gt ̅ccj)intXaup6ontht 40.Tancr2alsǣcboZ8șr1diagnostIeasiranspor"{roomemperatureron-frozenonditionsclinicalpplH.
D-66g`__DevelopmentdalidaaHhyroHormone-Relatedeptide (PTHrP)mmunoCUsingolhrochemilum0scTechnologyooolu>S..hagoo,.ibore,..hun. EndocSciences,abCorp,a8asasillCA, D-670Pg`__AlbiaesABcXolNj80ur0SisX9Va'''$u>D.Ǟagher,.ush. Bettd:Cer,xrstown,Y, gn.Ó yield producible aُ.0 - 108fHPYaogitaÑwonȗili8gXue(trolRIcirtv~1.53.8%0heveQCsyrhey6yoZmercH['řhXHsxioom@ebekaf൲a[MilxDfрMbottle[$v?Isyr#sЀtap0Nogni`a螧DfouHȞ٢_;`op=0󝟝91honclon:Z,adoplab+holKFOQIuideq//!/p>D-69`g`__COMPARISONFRCHITECT 20(FORETERMINATI3SCCITHMX???N.erdxvic. I`itZCҦ`ryBioc,nrsS`jevosÓar,ac"hЋs,,osnH1Herzegovina, D-70g`__RapideiyInfluenzaBirPsyalire`Hnscriptaploop-me(tedormQ2multix-polymerYcha z///,u>T.OMORIYA,.AKAI,.EMOTOITABASHHIMIZU"KOHNO. NIHONnry,ahino,apan, Xpo-of-car0eng (POCT).ow,alse-negpȞ`non csearly-stageёsQus,Pshoulduppori)-WgeneyƄooooom (RT-PCR)Ҁ unavailasЈ؋fa*equipmqd*lrpGFIn{studwec@х?(LAMPׂ7T)r?nlEoimRdgn(spondprrs͋+?ЯȈividuӭptargh commC/fewtK 8QnucleoXȇ(N(Satrix (Mwe>topec"؉WW0#A (hdem2009)WSލߍߍRadd@o RNAex0c fromATtro< (ZXoCorp.,ufhNY12ąrQIAi Mpit (GEN,usseldorf,ǕanyN aodanalyzoneXep9(L؄i160(L!CyrI(DX400,ocheXl,ӟ8zerl`), idPA,%type.oreYύ2Jok_]CJsHencDrEQ 8800 (Beck0pFultCAK.i| - "p`ب`qgeҳMDissh?,omIndarH|aaqMPbe. , 6dGETbasā xscQtby\َZ///6և^iAIǺpthatfcMO{ˇ~+Qn 36S_af?V1ou 0bx4qu`wtaÕ1p(hr0fuIsa}sucps꠮.

/b/u>.Johnson77776,.ӂ(r2B.Â"Liu3>. BramW(n'sospithNorernnr1osM/small>
Dana-Farberanc8Institute,oston,A, 3XsBPy@isoctr poxXY2__\nd_____hydrophobicity.Ƙ&wwwwwwrSƍ3ʋpoitrouloco sclec8abi!hichap-trans`ld z9΄"tԓ9(st[uttyـyytermȑWw 8P7Gnderw7 ith«ouengjHsM-CSF.re-W!)*ngGaHUJ luoXclyabd+irXvфȊVWAbdoz׌Ւ^x/Jtage/purxw-chhcZhpl1njnew(z1 (n=17)h23)8vasductxcar𦀔3;b`-r(rcycle-chealt8xs5)ÍҌײybResultFו_, 547$*balue≤ 0.05IؕϕςK}’٘g.ɘddiun8Xnddu4tinctfopA8ov50%GIaoo풳d17Nǫiff@ږX̨1L(Pv8ReceXrpgXcurvJplttop 5ݎXaCCa (AUC)calcu.Ϫfnghow)b nUC 0.898Rwhs(87%@8hՀ)˃/(2'$yametrym0i md"tI!ϕpluOP16,fill@1Ki-67os:ȡϻʒsucc8fudevelxآ9teh錡׹ϛ$ȼimmu@tntarge(ǜө@app^cPltileԒԟ’.

D-72g`__Rapid^ĔXiEsrichia0liˀڑ7r֔زc!tuybridizJ&a8 __\M.ang1Y.i߁߁߁߁2X.anρσρ. Departmeoflinicalaboratory,enminospit@Wuhanniversit(,hinaw1Hemlog/////*1br؀)Mackground: hEscherichiaoli (.)sheajorathogennrinerxfection (UTI).tcaus asymptoicactum,and+cuteephropyelitwithoeableK.pidemi:evealaatTIcomm`fleJ,"beiagnose)gh ulture[samp(assayXllakxo`n 48ours.ԇimathstudaostishae`d拸detng‡ntifywX@leMzs:sflusc0uybridiz QFISH)16SRNA-targhdITC/ntlyabelspecies-Bfxgonucle0derobe0I҂X@Z120߆߆،fPpepZonvon-ba R߄successfulЄ22u''$byoH(Fig. 1ȑ)lowxlimī103OO>~4CFU/ml.Ê߆,senHiv588.0%:97.9%Xel|poredialue (ppv؈91.73neg(n6pKwho`xcedYlяo8nclus:C(t,Fbhigh8XechniqHY2$x.$$MISSINGRADMAGEPECIFICATION6A17BA5F-3917-4CE1-AF0A-752645FC8DDA}$$Xmg`cindex="00030"n="ye"et="188"Pdth="3040/0p70pt>a>D-7bgc__E)cePf@ncoglobi0BiliruZQLino88 6ʄ///,u>Q.ȪAng,.i:Krahn.1SaskatwsooYK`anadooObjs:yiagnrYXerr`lorry(asmhicxleawro(΃t#pXm8gBeff:hly,麁uHlipasfundakeyleed.ׁre螀ormQu_^͂lӹSӈ0B:oPum؉zplaB2notlЉlic,rdcؗЀHg,reezRawYpackHicell@V0ouants5)addpsimulH/.Ʌ÷obtadom (diXtb.GQ؅rؠGBPharmacyEHng(c501"e601)changqWS-Rl`J/ResA ~BhysummTable.ax ϧϧͰ147p8΋b̀`7t71observaNA:applhX,StDQrm7_ha(fot;/cwzomxty.ӀكseloXט&substaڅn(por0nhe company’snsert.oremportantlyeaveemonstratedomeestterferenceshichnoteeneipreviously.asonheurtindings,a@exur_Xtudyo
D-74؁g`__EvaluЉxxBDacutainhEDTA-K2lusub)iththoutolym`gelor`asmaNAu0ifD.hen, S.au>,.Ȃhg. DepartmLaborye`,ԏFirAffiliHospithNanjفUniversity;NrKeyynqChina,,4°Coomo0Y`Ycells7770add]Dӆ/+!.Fiftȕ@sopibid2hμl-fre׆ԛtrouH)Arx:-2.5×10<>5D-76pg`__Bip(Tress)SixiehMeHdsœC(aris0Remz"abilityfesultsithinamilyfnalyzers

D.rmbruster1,.emma2G.arseille. Abbottiagnostics,Park,L,Da@TXbrp)MackgroundssayccuracyependsnrecisiP(reproducibility,andomrror)ndias (truenesmeasuremeh;.!iftenXrivedrPmethodomparisstudieiield0outine)l(one8signatPthe “referenceL,”o(rRtestut+D(noqhim2relat,;bsolute.Çto0cognPdXhLrologicalrȃatovidpargetaluiesingsciificqthyjb llmbahou8eable .M.urveyalidRMxrial@SVRMs)orPxiNa,,llucosHBUN,CrenRcardiz!amplwPwhARCHITECTSymc4000,8;16@P*)eachˇwHHripl؀ЁYthreBn = 93n@ntr򅼋񒉒7Bא.`@ggep-J:Ԛ*suhrsveragp30R'&?oK7asiyA_[f@Ӓsn +/- 1.0%O׃Ȓ/Y1pgM-5.78%+2%WAPr0.35s7.2PoD-GC/MSǎƊs0(Sigmaʱ typ > 6祰ncluY4 (??:ϡuto;clichemistrVyyߍ ProP(Cusppe@p0adisۃHknow clО߃atdeHmPdYOGĐ*8=XanyaAי֏Wy.

.ppan. Mod,nc.,d@PrairiPMHoWBack1nd:imit,yn`c{2Yi{rn8toPd/ssuccfulopS(uropt cedurPabody/Ig H(chPPovX;pɆhsitivʗո(sȆA.owr,RiescXah譨Ѕeff chievabo`Aququ(at8ړىbBmostdey_`dwineɉ"pXeoffzJM:HgQSsoxguidak,{dRPzAPjug`sɇeptao݀@lori (e.g.Hhylbe (TMB), 2,2′-Azino-bis(3-Nothiazo-6-Hfo؏xid)(ABTS-nitrophenol(PNPP))luqsc{odioxee)_ړ`i0(aptK.ձ0odeȚ"ex)b`ojח@Йԁoducibility.
D-78g`__NewNAšHFilterЍ)stiblGenoWhoBloodyXPurifReagxsgggdu>H.i1,.ubitsky2L.ȜhelBradbur. Ppfeciences,o@n,A,߂߂߈i߂߁ǂPortash0toNYGObjve8EvaluۣerXmaAaglXibmPla 96-weXfӘabWniPfrom( b mercavailalr¯groundanaPampKiagnost`posriزiР8tinuincse.cy4xpɱdۆ]equipmx.ת8WhbՌۆ"ӬLadiulk߉?9 GMMethod`d, <48Ycoll{,9cisacoagulP8@! yh.6chz*QheInvobPega,Zymosea.nuf8ur reProto(iultxI!pi ʌg2fragؼ(ibube fair0narrow.nzrhcзDwvaamo0k,tll-to#߁eachdAcroP™dvR.PCR풲䐻sinhtor dex qlȁ!yffhǻhnclPepngyieldsȎwhҗonjunB㞀umdirIystem`m:lsimPrl9xbetthan AluǏJ levelٱeuggest(؈ScouP yb+3OPH@epar`EHyCsoUAddiф1,ecfitЋKifugH"dePavoiӁX9spe~.

D-798Xg`__Ati蒐palbuha)ayC.ecae,.i,.ЪiaxRIghei>Un`ryosplǙt, 9000ielgium,Ҋ[:mprecisionɊignԅHmeasu2aig8lowlXntrola8(LiquicheckNjNjTMNj>Նalysis1 &; 2,io-Rad).etween-runVs13rang4.6o 8.3%>rQCсr0.8q18%uol.׈iwЂbo`WlnsI`than7%airgre tbcJMcHr+AlbU_Y)protethN?:>z(Pro_x) (n=): (10000/; 1/%) = 156+0.161XI;g/L)-0.q209.w>X2>,77776=0.921ess fou@yrog(-molyb assay (Modular,oXW5(831)̓Hcalibcurvemc23.715GsWoooo≥99.Ԝclimitfic(LLOQ_Юtxp. 39.8, 54.342.2 ׃xynojinfluemanu0dlX'Tct׈т)af0, 1 3060dsXioz<6p>5w>Xnclu0udy(semPtaene#by aws4tX |.ČiH9facUZ (Hڀa)xnnotXchiev})dyeindy hod,,ᏸssyoryscnpurpos/pet="10pt"0dth="a>D-80؋g`__D0lopf`versؖHybridizcAcREBA)PV-IDvailablHoҀutocaSCANGeypDetHuapi0mairus (X)×PXlpeciu>S.w
,.hk,.ˀ,.rk. RarchÈx0YDiagnosticSeoul,oxepublic,siXvitroiȂyшرǗr32巰hچv߅sĆbPheȀiopsicells-rv#soluIXuspaonjunߌijqW;_D`Hhn{٢gLIKDNAromO188-risk|(16,18,26,31,33,35,39,45,51,52,53,56,58,59,68,66,69,73)`(obr41yw߃x6/11/32/40/403/44/54/70/72/81/84/87ceemployne-tu`nPCRMY09)GP5-1/6m0setrbhPbaius9oCII.ϒall,s@itivwD,,Y100% (119/ ), 62.550/80x89.735/3x0elx);quenci*siIomparis$, 30QnegvyWutߑLpo3ident9figh-/low-Hkroup.ow!ءlog8Ѕwere(USi/3L-SILxyH|sRCCfa@ocar8omaOIaddon,?pV`~ ?magree76.9103h=_\ aGWO94.12wp84.63onclon:tlydemtr0at8cordwithߟzitl imP ou# ׊9fhrQ,ffooCag3<1copy8h reeq*oSt(ughp@`t\D-8bg`__INCREASINGPEEDNDECURITYFHEANUALAMPLEREPARATIONTEPORMMUNESUPSSANTONITORсH9ARCHITECT(ALYZERՃAEW ‘LOCK LIDENT8’ACKЅxI؆S.chmid, RPCHMID. MedUnhrbVienna,ept.abohorýy,AuPia,(LSI-aoc1SId`).rǂK]s@whAp+薡a(7ortexHȒ9aab-qrifugеA=og0\oџChȅx indd9Addo(j@yhubוResXФNjmvPș醍kexn`by`stak tavoxӉ-,Մ6lar!ats (@40)YGHcessexp8:كeecondaryrecipitationubes,orheRCHITECTnalyzeertisample.
D-82g`__Dlopaenotyp9methoҔsltioly`phismshuenZpCzu>R.vula,.̐l,.O.a MayoËXic,ocher,N, #.؀K d2).iaxngnucleotid׊sSNPs25531=al0funzOr.׷†CRa fragsIeA2BI qur;whiw0Q3P1(ouslyͧrif 4:setAQYfy2L0/Se,R֏g݁c1AJG]fNP%8p0eɠ!a(Riȳ˞BevHPKɐEWS:fluicplabX{33130G#zǢYmark oftwv1.9ȀxZsق4byגօ2؁ditNAussdiff8}타L (i),̀`A G KSGÌ?woul__Y (9010R րkz2sllowL;450A~06ـ3279yZD-83

Investigationfethyl{patternsAPCenenungancerthovelluoresce؂PltiIurvenalysisssayL.ao1S.an. DepartmeLaboratoryedicine,theirstffiliatedospitalNanjUniversity;NKeyyorgqChina,,@oncology,Ԇbr)Mackground:od0ifyלsqQpromoegLcell쉸Xndwois⋀.M0ods:bisulf8rea,NAampl PlymphocytxfHordloodoutZZtrans-cerified.Jzco0@nlonintolasmideceoyasegetpo itrols.`ir 9rhprim rdesigYHyRtarequ _Zcoms21pGP.2acquirЎmeasur)ȅaouble-sd-binddye (SYBRreI)gdissoc!stage77a47/-2s’umthum:!a(tptu (Tm)ǎǎǀ(eXtMWshowhat(afourׇ(NCI-H446,SPCA1,z520@isBww 83°C!low9un݁&,hil"(P 62peak|88 YhchK`pohTmzfullρ0łly΀por@PacًIlwwk@valu;W?RbetwYϒòHlus:AÚOOrʀRcribC?lle exhibitonoRicGon''__8rtigny.nteg@D-84Ppg`__Mixwqquitpox@s ha(s aneouOfairuCrHumammunodeficcy GGGCB0an,.ٌ , L.in. DrÄLaboorydne,esthinaosplaSpn`rPy,0engduIx/ihGObj :ouct (MFQ-0)ys(GDT< (HBV)Ɍ(HCcYh`IeuJalУ晊 ,yreec0s%icaxPuridprloofbil8 lewasseJ 58(cserumas栀萜iz$O@thodXTaqM(b৸igniqiٙ`,CVIV# sXȯputHą(tubH -񃒫)0ar 逧A7ҍ:pnew ,heetectionimitsrebout 10opiesorachftandardlasmidNAHBV,CVrIV.nheest58licialerumamples, 22, 16nd 3e@positiveithQirus`respe(velyyisewFQ-PCRystem.ompdradonELISAethod,hishowthat 23GGG@I?G.ima-Ol(ira1,..arcelos//,2//J@.quino39.alvag4M.̀an/Scartezh/ Pippǁ߁ݓ0߁߁C.uidFederUnr(yAPar,urba -R,razil,ჇMERCOSUL:әXبPpteC A8yIVitroistics –SM20,io0ʢxi0-JOOOO0OOianocieaVerHp,tЂׂׂi!ׁׂmςɀǁɮBackground:oxd[ treat`aؽqromini@deperecoid@iAehlogicgthmaking\r@t5gbmportterms1rele8Ypxe.e PWrocedufrequlygȉ:er3cs eshiftPials.g.spauminfoil.׆oalid®׵׵׉wI8脐Ȳpilexyasp0yMods: 200_ aCȌusv iPousinbyoueaboray_envhJ=l!be(etx=llai;microscop ?bdo``ki`jsourIllowCLSI28-A2.Ԛsulb|0 ZcomÁir拟,PearsltHمignڑwastqu> 0.950.҇+eable:Pobserv Giarmb1`i>Entamoeholy b׋8i(r &l),bxy@Hom Xrcy-dra0wa ,8ǎ fabrIs3fac8plihc@extuؿphbladdHXnclon:aspȘ8sI`iIJhɁq&xppWW,𻰃z3sik'`Hs!abuoHorɄ o)sXى errorа70"ù++8raۄbedx8ularȪxow7 v1'f0IgW.)mbp:pbk1WednesdPM,u27@a8p>Posteression:  2:00m - 4:3Q

D-86g/_^HPVenotype/speciesistribunnothimplendultiiinsmongenwoP.'''#M....ranco1@Barr. Laboratorioabin,rasíliaZzil0Pifícianiversidadetólicao҃G`pSulPUCRS ortolegrebr()Mckground:țOiHhpthanrHet[fjhaserecomxdedecausxiffȂpcorinctlyWisksoeveloptycervlAp1g^hritp!&carcinoeHoreoH,gnablx(ׄYߢ,hichassote@iЊ`rd*Iiߢer(urm,prevaleډvargeograpy,J|)(r(t Xesb tooThu0Iaimthstudy~IE`s߭ty!ourlinlys`atab.Methods:gh`troYHalyR`Bxsa񊩃betwaFebrua2009BSeptemb(2010. 2,134wapluxllromGCtesaBitregaevoЌ5difisp  {p8ЎgXA33.0± 008ear0Ck32.8±9.99W729.'# xmuPapilloCheck (Grein0Bio-One)MAus 24oB(18igh-6ow)ҏXGdepstȢrat 44%njposve."ȓa52.6%l47.5%8haop؀P჆56.8%s 40.8(p> 001)lsoo57=62.ɀTetx)16 68,/55xX42Ѣ'GD3A1, 3 X39҆…q1Q^si9OY؅i4072Wh pكӆc=A99p8JЗ7a3p3i7‘tatxC]`8,,oh31l7.`lt;_籟n 2519.3]1).n@d10#eow߈ۍ 44ۑ=w|1=4(p )w 23 0.9ۉׁǒCos:observ`a8RityAϵЀA?agnca- poj`a Mq<,o?Udhribu,B2#wwtbetwePm'addh Ѕ riskndowiskenotypes/speciesnheemalendIresults,IPtively.owever,eanhxclude0atYseifferencarut atomicalit tedQmen,"explainby|isstropismfaficـHPV.

D-87gb__Performa8valuationiarotHIVssayethod ADVIAÈaurS..ЅHbla10u>,.hin,.artH.uǁǁǁǁDžqChowdhury.atlowitz2M.arlievw,qFoxρρρρʁre W,.ake߁߁߁. MiiGׁi>SiexsealthcADiagnosticTarrytowNY,WWWWWMefioMed)!Bronxbr)Mbj:Ԟ p>wpȟg/Abombo (1)9*(nvip-mmuno:orBsimaneousualitvetahuXdXncyrp24tihjabodqto߁߁ީs (US).si0ityp3w@edamplfrom@h`-Jpopul bothryE†__>܉on.7Ks#7ۈas 396-poLobtÉDx (NortoMASeraC!(MilddSrm}ying 3647aidloHUresps#rep0SindexreaJ (≥ 1.0)rn<rty-fcommerci@vailableseroconversplwsIer(BBIilABIami,Lz,Bioclin"Pnh (FrankKWHOɤanRSdard1RAT(90/636xx3dilunegcplaș(ol0aly؃Py.@ʓgLatudyXvolv20釙twouperixi $2'' *inX)>bas 2a8HpdosPookff8(n = 2134)+ (O!ZLJǖ(nfibNATus1btҬ0Tim k(k,ɕ1ɧɃR#:lp)DŽshow,9,i100% (/ )G0''eH99.9764x~oB_squi@نrefHnceӥ vendcertsiobv0g 0.98U/mLk_atx%CVA8hp6.9%_ange;dZt;belowrcutofivelC/Addl(oK'';(1428/)s (706/ h'onclon3żi"APτADVIAaurzAg/Abmbo(aliccur ,uHmrqualit#simouscUe`x)antigenndIVntibodiesnumanerumrlasma.

Exiyer™96;b@trumwiHadva dphunalsuitabl !̣.cceȖp8txsiRӉalsWouhBH.sh(uPo(??<®0i>P/CP/LP/SP/KP؃TKicaY ,Pllhi`viRextendT@limit (y),ynamrangarɊ rxؗ010pies/, > 7g0.999,lhSXwnogKcross-ۡʎnon-\T q0l󙑗0$exrrel#*~labЄِѓדӓstha3kEcpH)ɗLover 10yt -20 °Csyߔߔߔ> 煠Њofea_e1hayop@(remix)brѼxirSout@n@duci,k׌Dxm,w#1,quipty쎀in(ȅڪHtcdggrone-stepT-effaPgp`crerapiRmajϢuwq,
KP inlinicalamples.

D-89gb__The'Laboratorylayseyoleneducinglostridium BiYdifficileۀ (C.>)ospitassociatedxfection (HAI)sy9mentIaimultaneouswoestlgorithmorpidaofÄ߄߄b>h///*u>D..ettwiller-Gheri>John.atheremH,ortefferson,Y,)r)Mackground:i߁鍹spore-m8,ram-positivenaerobicalhatro8Aexotoxins:AddB.tScommxcausea(biotic-iarrhea (AAD)Ri8cc@ts215-25%llpisod`.__ prequlogaglthcar脯ymay`HusUniqSteyn $1.1yannuy.OObjveToω,endecto;alyet`DpssӘmembrnzym8mmuno(x 'Pcglutamhydrona0 (GDHcSBɝng[device,yre0XvHiaw resܛowm1treapXpptIsolswift聠ހ^(smiss.nptervHuhxanQroo` l/A!sup4$numbH hQqb@tۀpȀpOY(UsafeஆriskRyoradvut`es,hЛP脑regu9irJóJo(áX2xPSGo(NPSF),r 07.03.01ߪthodAprehQvi,i-discip0aa`Prch 20107WWQach.`DIFFuikhe(Hl™homPmanufactuxTechHnc,裘odiѢ@Cconfir8Hh0< U‘ scre>ouni(GDium,lrWlesn < 45inu0OٲӌX(de萂`lidu*anhh,Zdaaa҇clockAfa@oh'6trolفsw`@/ted_҈:urpIcHٵ(sllÅnur"p@onnebth`ondeaȉ(TATȥ=bqan#fw/)In09,PPQRϞΘvGBb.95/1000scharg"Bafmϙ57HaUdljljʼnptw82a 40%[(arPpon34co.£( ⵗcuȉhospiyzedica$35,@arZh@AZ$840j.dl[ЄPvolu`ɉg42%ηa`o766%pncl X:ҠϔϷQ1diagnosist0sa8ussmx󨿐Μaoғh8ensafetsignily7


J.Ӏhieh1,́tanley,.alρρ2ρρU.abeck3>. TPMGaiseregionalab,erke(,A,Siemensealthcareiagnostics,nc.,osngxy@xroductsmbHParburg,ermanXbrp)M0tӉndbjepves:yphilissultistagehronicasehataneatHifeated,info xthe؀bUSJEurope.ransmissلprimlyhroughexu`cpactrerx(mor-to-c d)n.ortunlQapycuńypreve8ނOIBecauePgsymptomhssoci1xttattributoQ؂xlaboratore8ngJnssi`tdsis(erologs (nrepone )zm`hmmon( dȂ[ ypesf f@aidz˄ށ.s!aginiscreenYreePs-QimmovidettPdetl0XaaLhhsq(perxh`@ssayIMMULITE|®OO> 2000 ()xioPlex 2 (p-RaALIAISON (XSorin)steȌ1ahbodies.wMr+Method@Alwe`ru`ccor*anuf8rs’strӏhA@Ʉ01360ampincludUL&aromgnHo`mum 1Hx(lJoiXPcross-`„ati0ؖ9+spirochלP2glXifiPHneg(Ъtw%e.݄l-R9qYres@fixqr uRPR (9tiTPPAngl8xc0hofamaY̒SIXa9iؑ}erkflowisI{batchde҇: {oN=de@ ˒%Specpc98.36X04%Tlt=, 4\IgG (97.1%tyTMe`悗gMyt55%qK''')χhow@@h,abXעT1-to-firstEgb”35inpubsequYdve`18hcoz;ǃ40ǃ6{25f(~1C21=8oy 4 hCos׋WNph_XwrBDŽ8miss8ሸbyw''܃likedu;Mschnonaǂv'ayz؍siPar.όȁ(ЁVsystemPermwell.ahiowdvagd!laboyAulEneeaga2/s’eatufun &bt.

D-91Ёg`__IdȧP\pMycob@ (tuberculs򙚅istaPripЀ/ȟiazirSournhina</b>

X.ong,.haTDuo,.e,.uWBing. Departmentfaboratoryedicin0WesthinaospitalaSichuanniversity,hengdz/i>,hi233Knon-ok, 218 (209 acid-fa(il (AFsmear-pHtx, neg(utCRf)'L(6ws32}WWesPnum8ix bt0b0'''''''#was 82.6%76/ PYoXȥC_te!rɑ33.0%(91/ ҁh)25.4%(70*6 (73)Xmch2%(60/73)duʈahveW݃15.1%(11فɁe.ͰIdefڀgdtwoirst-xti sʄ)އ!f18.852yj.ɺ󂠮, 74.3%!70)ɀcbx1x{en?cumosignBmutzrpoBҴHF?xaCbinhAaxyzA65.7@469WOcon@g\/> 530~533Yl78x (36/46sS531L>. 80(59gBmediS315T1nąfer,-ד~F(lly,咲&orkdayjoЀ(2Hnth`itvoÊX`assasoermuickzefiH@olnmgetuculitlrapproprreatٻ*(uceransmisspXd3.D-92 g`__DYopaȁ@lyӶ8:mmunokScreenDiagnUroiAMycopla0flPhnWo///+E.aar,ͥxashke`S.Ѐgiv,.evy.PromticJerusalem`srael@hBackgra:luush2Qe؇phabnycerQjcnexux"wY,exs (suГXUdspp.hhoisۓ`ahȳSubcЭxl߅ytsa(bhmpl+up70%ads cyut؈`Ptelab8 del rȃdžbexb(eriuma؋col@zin(mblicit annflammatoryesponseheteruspitiatingcascadefventseadorecipitodelivery.urrmore,"anttrtimzbi8ayexposedaac`ialhallenghcould0ntrib"athologiesellnownmo Pms,Hclubroncho-pulXadysplasia,icuPdisea@andir tsyndrome.ts1refrucA@diagn aectio narlytagxr ȁt`meHd suchs?ultuxorCR,XredcHsencMycoImHpoincolz0carriersnlTaq nofficierftesodify؇subjhave velopڒyჰriskad0gnancyutcZCurrgic9s portihHfar,unssf(aiu:)igensYssays (usupyTCCinombiq ),hi(doXnt(pquys8vatykifalhneg0answAstudwhvald8er+cktaiomp0solfq(asUreahsuitable`iaHns؍lb a@screؔTP؄wh@xmmuneO8uroQtЙ?.el:ׅxpfir;(highqfELISAJiȉ/pp."bodIbysbn*typhsympto x.
Alim먁]newʛ6dehigncphperc`0!/X\-7i@c: 35/82 (42.68%)@ rup#fmbra(PROM53/144 (36.jrrmab(PTL)20/603.3΍~Xꁡ뱺 Ќmȵ鴣\12/912.7%)o)s0:*??y2ix)ㄨfuʪ7O+,ovidali: pecپZ>inguisxtw`U+ҫВ8GAp`oEyytoR.

D-95g`__D"SyphilTPACi/ Qɻ)@aSystemX 36WWPg 5bg3u>E.indhout10u>,.П!sM.heng߁߁2߁߁G.ӊЉsׁ3D.Mague 4>. =ii?ׁi>Fu"DWijcP,eal///؃//OrtholinWRaritaQJioPrYiighycombe,nitedingdom,

Treponemaidum.ԁPpresencefntibodiesoρρ (TP)jgens,nonjunctionithon-tlaboratorestpndlinicfindsayid1diagnosrecent,Pstr(ea s&nfe.oMethoHQmbescribЊqitativemmunoass8techniquwhichvolvق`kIgG,(MIgA7stsamplbiotinyl TPehorseraheroxid(HRP)-@elgP3y-xqcaptur3staviЁ RwellunbteriarmovaashHepہ@,asaumin%sXtproporȔ0qx-$iMerformaVITROSTP@B8dafrmercavaile#?esulhyexكHa!sig1obtat{cuYf.Јis0drAdl@hre.I7mcrosibLin@v f 28ay)cluiu5x׀pїcooȐfromea؇)㋙XopP98vg1.6% (pge 0.9 - 5.0%)*ru3.8&1$8'4.3~3.0x6.5.Ì WeҊcipu1831nonhy233%ag0xurrmark9ȊȈt!zag mQQ1008193/ id؛99.77748/1752fqolu=2cordw8zOOne:ZorixBBI-Sc.ofese`ZidhpotЁتpglobi(BruZTryglycdIlipid,zB,ipye)ɃҘgTupdifdH Zetwт߂collum (SST,hoЃXvyȢglubes),He؎pȿ@(LApS0um@EDTAciaGíHluy.׭âpmee\wpxtineedqu u𵚙s*ndDlopq

D-96(g`__P'ڇ1Ac s®IVbo,,UniCelDxI 800E.OUX,.ROLEAU,å8HANDELIER,.ARGOTTSTOIA0.UHAMELЂJSSaBONMP,֣OTELLENOGUES,̓ IN, R.ALCOU-BRIAH,πLECHEUX. -RaxMarX@quettFc@1es(o>ryasoundoe 100%nloodonoramples, 99.85selectedegativeospitalizpentnd.
D-97xg`__AberrpsʄCD8+CD28-pʄT㊰tinvolv(tidneypsplinfPa8 DŽDŽZ.uang<>1XW`/u>. DepXmqLmyedne,ס)ChinaȚaSich@iigduIxЄττΌτρQneplogon,___]aUBackgnd:uss`{reducjc.ueAJ ઺ٞ48f(2,.alko2D-99

,.nderson,.ooper,.ice, Wheelaoodworth. Verbiltniv8ity,ashvillTN, :s0.58 (p=0.26);7400165734865_0210ˌÃ"0%9ۍҁ18ˎ"3708\(62\ .uhxqtrib`ڪhgt<Y+@ut-off1SSPsvxr54g/mL, 15U642]97.9c0.48$CT,ი9lAYci(y,׀ipoe[ihooh (LR+)indduXƋ PtňQ: 73%, 70(2.5 (); 696815i6ȇ‸54CPRq62(1.QmbigexP.yielmvщ'.Ю`qboІa:$2,o;mo(hq = 3.3.d3.3߁jY8gϑCTlo8show weakbilф@opui0߷T9>{ablege  hosupiro`ihologydis8@moArЁ llcystemlamh

D@0ojggDihtĶ8Æ iPlasmoh/RNAHumanlP:pSessSuitLargeӇXeala`preeyWWWTu>ZhP,.n,.ang,.׀J@ZA. In tutJBasxM SnceCh(Academ:/+SolV",eijHSKr)Mckgro:E8᮰i,0upl8in'vemaglobtrl,i@ז؈Plabohorim nhњagold-stardicroscopXexam-sufffrom荈pedlhxRecentlymergeducleic-acidetectionethodsmproveheensitivity,oweveryackthroughputequirforh-scal8creening,ndirumentᄹpreparasaeaoariabdiagnostresults.
NAnhoblood.8t m0i`xbeserepthatF0ojcxervregႰ18SibosomЄsqfouruman-inf9ngspeciesbranchDPXhnologyassoy"_y.evaluaɁ9ass(usc8u9Y.alcihum y esρɌfrozenh(m 49icroscoplly-761vivaxp hnyanmarҔ+:Ԅcannerpa20μla 96-weltirmat,ZohQpur6,s`ipat.Jlimi2j0.04 e/ۙ?lsporЁhmbh (R2D-101HogcComisAbbottrchpeJohnAVit ti-Himmunosm`arwA(.7772u>I.et,...ouza,.Ѐni ruzxi>Dó(damér,uquaxiaBrazil,7B@gxnd:ȸtsär(()鮐nem)(cnli1disecu*}usuI(ympth.ow1, 85%0d냏ifp(gcirrhos)hoc(carЄX簁ڑIbodP by?50firmnucleaci˃cistudavڽm /-off (S/CO)򬡲ҡʗr mmonnegpwh!obj8Qsp%possibilمꀈYe>asheX(se-G6MedWalyzp376󷡗9laboory(h`lXserologwe8reaa+77per酐up90fَ۠Ys’gg!rom 16J1ea0old ("50.1243 (64.6%)Nfe膉d 13(35.4(.zy(2/i= 0.95 鄶V, 202 (53.7f74 (46.3732Anoi(diffؓ"8Xgendh(p 06)detection.hetratific0onfanti-HCVmmunoassaysesultshowedHatone101@en(withow/CO0ngingrom 1.0o 58wasositiveorȃRNA,hil7 (29.3%)5.110and 185 (85.2abowere-in:Abbottrchitectv.imilarly,ρ64ǃׅ9LjLjLjeight08408ψʁψψJohns(Vitros
D-102ohggElevatyrop`narish-Herxmer؍xickorXrelapseveru>K.oek1,.elly. P(e!̜ories,ɐlogBЈham,סp@|Microbi -N@Background:Ԏ-ώr (TBRF)susbny `Boriah.ׂypor@`oaXrmsiiVIWc8CtWAmplyJcWQJ-HR)inccardiac~CRZA 75-year-oldoseeȆlocalospitHfebrillnes dyag`.ased isyunremarkableXhadHa(0ebloodsH.rinalys(ralnuoPWBCeria;`difipE.coli@i>Chemshowem(BUN = 29g/dL@tie1.3)lAST14/ALz63y)nzymhluco(154_or0qc8lyt)ys(n-#acuhe)tpanelHIV.Xb>I4Z(0.03g/mL)@tۈleukocytsx0,000/mmϟϟ3>tmbpen(92wwwwwp*smؐs-co8pirocheuggesi Xg ()ZU.segvXAhrkpgnƒ0)Rmad1mSQ@apkstPuxjshsymptoms䇸lXA 4hur8OJ -pmp0,plletМ݄idlyt 12#,w0ngPvisiP,becamp436howikȆ&.Y0.28ۙ/-nsrto: ovasunit48 !96O!nexGimprov(11ang`sol.ƄHtdayf nsPPc$'0؅235ׅׅׅׅל҄h}ʅqsconXqp諻munoassayWXernAtGAonclus; xall-knownw鋐aמעtudi`han@pnlyumnfor,q8*-16ppirZ тqc RpityWPboag@inflamȅΆbeenhownoecreasehe-HR.epsisatesultsrompencefnfectiousrganismsiequentlyssociatedithhange0hP!lammatoryed`ors.levanbcarcroponp(ssareommon.honrfirsporȀrans9KTBRF otial@uJTrelduringłlud|dmemb(Qtegrity,acter endotoxi8and @boticysfunYG7orpounlikeb8dylow-limitelogies.

D-103ojggNaturHisInde`min(CVIBAu>S.y8t,.an,.oroz. Be Israeleacss͓cCxer,oMA, Illho-verjqOQx=[1Դ-a@ddpo9(3rdD-104ohggCoexisthetBurfagb`-HBnh(chronByuaits:XoxypeÂmutSp[re8qscript (RT)gggg"0pt">W.iu,.u,.ang,.hen,.uan. Huashanospital,udUniversity,Ӂghai,ina,
esultTh noignnt fbetwіZWWAbarږ,derlMpor9BP؀(Table 1).Yמ݁0p=0.027)Gepyp001)sWbmo frztّ+/+O0nL,numbermuH@`X|{marked `r話Йdž2航HFigxcidxcɪccurrmosiN-랠d(p "3)“a”V<492wo0qS eMHRicoopdÄ?;Ê4CcX˥(P>(5 meHHtushowa ncybeϑhigz=4,3)ï lon:Pg_1-2.90%vd(0Ë` aͰ۝(i firʙtudy.QobvY1%vabilRڧlj.

N1σb>D-105po/gcRelshipIL-18NP#Suscep`PTBisnË aM.ucuo.i,.Ӑ`,.گaB.ٳPi>Westcosp`xchengdȀʁ/iBackndUa srjasДБtt`tPfactorslay8x+s{Xref蟃iHt>sqp0X؂!sHЃ(uld蟂ib{0erd98ho)m lea dopmсnew*hyla8Üt *ecytokInleu`() ,(yinn` acquiimmunx.iaimuȉIFN-ducrshTh1elrugisԀ,atukiller-toxich(ghgFx,onperiф!u)roinflammay(10m{.Ѵxe"sultipyun†Pchav9ǎTRecqf0( {ۑY-mr}IexXsISXlalXihkw܀hHlogʊeyudisobjQ0deX8he solymorpms -607/C (rs19465IH-137ǀ8723Iassoc gul atuberculo((­.pohhw͆ods:ЋolW8 dopY320i:(male156, female164,eange29.42±8.31)ithTBnd 314ealthyontrolubjects (J8H3026.83±7.67erelledromibet`physicalxaminations,lunrelaethnic:southwesternnh`,CRmplif or-607CG-13XvarianYasarri@derheamndi)a 96-weXpрQLightCycler® 480Ҋ-TiSy8m (RocpDiagnosticPenzberg,a,ermany).irolymorphismdetbysingZhX-resolumelt(HRM)pthod.THgenotype*aleequencie$analyz ,eparly.
B.ف. Wospital,@engd<P>0.05).Ɛzean2io,Hx aus8nHggρoooɃmtJ󂘤rtM204Izoobxv(36.26033/91)follow$JV+rtL180M (23.0821oveXlEO5.61q6/57)Jmorji(ڈ@0.597/34)M> l,@7fvǖǖǖdžˡConclusѵemphasizЇBaۨAhxgporlopproachPZniop``ه9apyPp>D-107 @ohggTigecyceuscebilitydrieffluxyPmRmidruggiAetob aumanniioPhhW5u>PHe,.ie,.ang,2aL.u@X.u,ȤanW@.DeparS1abo`orydi1, Hospital,ichuanniversity,hengdu 610041ina,
Acinetobacteraumannii*hasecomel(lhalleorhenfectionontrol.igecycl*enescribedsnewopGtreatme腠.os,utr stillonimXpretripiasgainsIisicroorganism.ecxlPreducуv77 edanyPuXie0andeffluxystemsfyovolv+it.nstud`usceptibiliȋuJwrsolatfromPhospitalWernhdem@d.Methods:x!26tescoH!icspecisiiz`pati؅ idhifi1uryplexCR.̓muhtor9HpICs)ggaсrlsmښ1Б6usingUSDP7bpkposEYTiaceae(leS] ≤2 μg/mL;medipI] 4ޣw[R8)cs%adeBjRodeSodeYodeJk!Envig"hrfiـsequ`iɡlyp:EO_ya@2-8erag(8e,QO46.2% (12/26), 42.3y1{11.53χȄ:orsl8eouslyaX00%)SneiR>7*KDtm؝thadeABC/)gu[SRwo-ponɁKz׌ ssocqdnon-ߛڅ0vi8port?b숷(IJKGClikn( orpiccodٱv[8sOXYZbXDE/𔠆oélon//q? vp Ylla鏸rroXC duc@8ivy7wp

D-108 ohggPerEvalu"iaro ypeMVGssDVIAâurD-109ohggSȊ;effepHeptBirusenASxsqSPG21u>G.ao,.eng,.i. QIn9ioDiseaHospipNingbo,Ehin X/a,.٭g߁߁߁߁߲YYn.eׁׁׁׁ״Hu>A.̀agna''$2''0Zhou@Pׁ׀Rhex,(c.0cNYPGdd̽׽>bjveHovelopnoPucleaciurificȡ0@Մ|ARD®oo>c*dioctforachi`aƁ| treamp threourimhrame.levcurry“goldtard”냟reliuplts.Zmadisad#pARdelaysetweevailabiltȃи:initimedleatm1wAowaly@sens-R0irtarpsepqpc`seapxiю(8%orvery,l vne܈r؉ shpingQbdڹppni>5xissues,wever,heinancialost,ersonxtrainingndhetrxentabpntrolsequire orev carryovercrossamptionmeriou(oadblocks9wides`adolecularestyhospit Hs.ԄRheonixeptiCARDsowhighxnsitivityfullPutomatmi`fluidicevice8sign ductultiplexb detecfor`ps diagnoP.ethodology:Ɓodam߇,:purqualaofnucleacipe(Aone%mhcfactorWeavivelopa-stagfm:pathcorporHsothxe-basa`sillumn…iso yschemin aXng2,olayOnh1lwhh(ro0ed,el(,eNA,CR endpo`8dyBPareՌɆ@@m@wiuty r0rȅQer.֐`dz:׆aspikT蟘mb`IClbns,ŀٍiyerococcu:1.0;sep0esIГbench@p9#torecїl `evalubympa260/280m*z3zHiohe؏8phorseNXo3$iPKxXPC`tweesђoem(8iYߐИ nѢ se.
D-1110ohgg?A@rac*NLAIB"T`sMRSAR`e a,ʐu, C.uang5Staphylococcureus
`@correctlyaaegXrzor,uggatqappropriatespecific㋒hadXloimitaityybximcoooj4oo!owas3Bo bweisߒߒڑevenoP, ts'5GC@lus);ggQԓb.ȅver#Û_!mosْ2ddtage郐hi脠xrap؅Bmprepateps.D-11bȁohggEvalu HBsntigEnzymemmuno#ChronHt@sЀPHu>Makiw D-114ojggComparisonfapidptigeest,LISA,hl-timeCRssaysorheetectiKnorovirus(fu>H.im,.ee. HallymniversityollegeqMedicine,eouloX,epublic , 1

Kathdun@rychXMedicScieDhulikhelepa8@CollegLbtechnolognXB.oi`anstit؃HealpoDhn WBackground:Viscae`i8XVLYborne0c,sapdyhli@etracellularͳLN˨p0(id!acrophagYneutilZthu`ost.0bXeIVLo,hH(uh0ylyxmolecup,uc8yaxy (ROS):nix'!N lead(dJt`So,RstudyRertakovibelondialdehyQtatR@ttsbeafthtndark-/lrug3hyАol>thodՀaongX(hiXiIdH25YfirmhcasvWW(romI*wy [wefXbfourekRwp嗓8extchdsubjamemaSenlQH .ΏtM(MDACat(CATSuperRismutSOD)lpth+GPxReduc7SHVitamC"uEeressayednloodamplesfLatientsefoxtreatm,fterndge-sexatchhealthyontrols .
D-116ЊohggAssocibetwePolyphismInleukin-18ePromoqHe @¥XcurrenczLrrans(non hineseȎPopul">Y.1L.ׅ`/u>. DrcLaboratoryedic,estaosplaSichuPUnsity,0engduIxЄττΊPτρDivi1ANephogwх, GBackgr:(IL)髰Ȅ`inflamxcytoxwh(0 9irclea@ceevigatBeffec"rIG-137A-60XpɁ{um0HBVПvHlZt^Lj/Methods:8130DJenpint.ԩs’ef2-upZ44o (ge 16-56)llǃņip׆ayblgiwongle-nuoti*reg4Gt+o񌹋ꌩy0-olu meltQ(HRM)uranalysisuFN-γt(HELISA(n=)[dd%end-disycHa(hׂY81)oބR49PhocamsAgreH-DNA䏿 2ardsځ211/Qha@WnsultGC (P=0.021R, 4.47; 95%I, 1. 17.24signifitlywith׎RGT09T00W1.32-12.13PalsxtroOOOadvoid)׊NGGaotypeǕĖϖthC+CCs,udiȌ)ItlHtp>5`77( Âȇ'ePp (figuI.p&l1NofPtweenl\70ConcluA:uggktߦϦa 9outcoh І)gn.:G9tIacWnon˔arri@riskUҲub;should beeinforcedithntiviralherapy.

D-117PoggAberrxpressionfolubleo-stimulatoryoleculesnatients HBVfectj.hen, l.ang,.i,a@z.ufu,uo. Departm0LaborKMedie,esthinaospit`Sicniversity,0engdz/iNackground:Tell;fac@sD28dTLA-4Z@irPgh80D86rexasepJSsjgen-ding soAexmʃirHon.heyimportyhPlymphocyte튐atx(lamm ponses*bj vPf:-studysoearnheQ1yaaot1rHYmod2ȇa-u mmun!ur'9proc./Modsv8酡_ߍ[ @1280FN-γs20ihealthyhnt@CՇlevepweqtifiPbynzymenkosorbsafurJcorre3sG`oۃicpametuc`uc s!-DNAktyYHBeAg.thaanalyswperMann-WhitntySpman's^Ak*GesultG>erum)c Ћk9psLbsXc(l0P ?pthh ts (aP < 0.05)0noodiff؊1betweetwop2qLm{w;%not4obloadws,owr,7thip όΪ@ڃ3Cluq/aggbo‡ivC(Չg׀G{aWyRaleadфӃdu;,淨lhƂ;necrotizy'0ork ,own-reg5Th1fӄׄ8+T,3aikilȥ.eA7mamoǶunˌ,[

D-118ȁohggPۧ:evalu΄ADVIAÇHaurPIVg/Ab mb0I;inthPe{aaboRerviomɇjhabi su>R..orizzi,.‚,Ғharada,Ӭemp(G.cv . LioհHoVRnItH,D-119ȁohggDevelopmRxr`Tranipt PolyXYCh08axbdhterf8nammaleqADetxycobإumu808s qυυυu>S.im1,ف">2J.oρρ3ρρȅxHPׁׁׁׅуρσρT/ρσρH.eeρρρρ. quXq90reduturnim(9 ,oluurmreproibil 9clonƄ؁z*cHJ)Ase(ZmʙHl-yՃNASBA.D-120؁ohggCa0neutrophilhtribuC-teAialonpomark{acuteׅooolu>R.a,..xusseahfouz,.ӀeddKCharaf. Any)BeiruhELebanonH>· imkȝ*abilityfeutrophilolumeistributionidth (NDW)ndompareto-reactiverotein (CRP[calcitonPCT)nheeteearlyepsis IntensCQUnit.
st!.9771Rgastudrl bȃ/.b>Ҏ>41H1y GGGB20@箏55竟81B.UC' 7>higPؠ ???`77>Ӂ߁߁ް߁>eH80.877) 3+4)ersuson-1+265ZOOHtoff=@9t 90%nsihity, 9 ` e iʶlueÁnxC//?//>=r5%CI:h35-095Aoͺ,nPN0elamprocromuearP,18KpHW>onclon:analy`mancHsmpptoPrg XeIt薰QҤdiagn(acacy(P[vailCBCmaypmmeXai܂`(_p,QvidQsibil6disxfirrulout.D-121ohg="0pt">HPV 53ND 66:ANHEYELASSIFIEDSNTERMEDIATEISK?

O.alentini,.rescerhL.asettG.ignorRCZA.orM2Ma, Bhilanesi. Hospitalfesenzanoalò,ɀy,D-122(ohggP6IV[/chroAHepjnrb0crEarnigeri???:u>J.KOYE. Departٟporyc(ces,namdiziki UnryԥAing spital.,wka, D-123XxohggDISTRIBUTIONFPVENOTYPESNERVICALAMPLFROMORTHERNTALYOMENO.֓)Pi,.reshL.ЎttG.ignorRCZMMa,Ѐroz, Milanesi. Hospital9Dpno0alò,ɀy/i$oBackgr`d:ꎨmocomm@sexualtWworld(wo*qcurrusȓJF:ard(lC9rix.hi@+protQtQ-risk:typ`1618,ca@bout 70%hiccas,g|low{[T1,espfor 9K8Jwarts.naAgramapvs2007zord befvȉmuk^ʅ8oowhr,߁,ӆotgligGnyfA J !ourata@u8g fia9gN hЌ:ucnUϖ9fulivaddЪqdtegilphylaxi>ethods:scrap0peci obt8(from5QJanuary11)3923؍mgPbetween8D (36.7)@O permbyCRmplcshybriZ,)erci kiAlphaStripz(cs)zINNO-LiPACEx (InnoetesultDNAde518 (64.2%)![24.8:sQ onۓ.蟱numb3456݁ږejreApnPses);o0tei'e:@(16.9%x31(9.3Q58(7.0R3(6P66(5.7Q18PC2(4D9(3.4R6P1PЂ5(2$3U4B39U73(168(082P26P1%Aʭ6'''e 548 42HS10P40@5b144#Q7V43P69/71h_oncl,',X58жؔ:frequJבבҖ O8ionsixᖈ /,7q6aЁCo54J42,ߋOI@Y.oPcuryHeoyo؁x1crosshr",-\anyw@yaٞduoriou чo.ԁalsox،casielD-124`ohggPaEuViteqtCrxAbodyĥAss`KP OOOLu>Y.rk,.hoi,.im,ľ,ȀH.im. Yonseiniversityollegefedicine,eoul,orea,epublic ,
D-125ohggDCha@zExtedӠA β-l0am(ESBLMe8loM@Pseudo`giaActobڒ(pM.yer1Jrtellado20u0R.uil.spla3G.elazquez4N.ƺ0ñׁ,зlmadize="2">2,.ird4ׁׁRussomando1>. //Centroaterno fantil-HospitalClinicas׃׃׃׃i>3׃׃҇Previsol_____i__oobr)Mackground:Thextendedpectrum β-lactamase (ESBL)re zym`originy scriberoberiahatonfer‬lesistanceo_ic`bioticXxceptorarbapenems.cHears eefMhbeobserv0inon-m(ingram-negativeAilli,uchPseudomon`aeruosa`dcinetpp,hi`agmaagxfictAMelMɌ쌌?9ȃnj__t2ztrePm.objistudyPBm*frequ(yiisolP.???8ourviron.pplą1ransverszdudithampg؁XuH+.,om(log؃YH(piratorbloourHYrkm xetc.)p(ڈIdif pari Xhealؚhhi*Ju2008)Juh9ЇinhReftazidimnd/ep(qa؍qux18m,Uhalomirm'&21 c#.Ǜhods:SensvityJdXagarumow9)ruklLabo#ӛdardsیphenotyp(*eO'!.ā_SpojeperxmPCRCTXM,EMHV,ES,MP:VIM0sesults:bϓaؗ`Ӆt4.1% (10/242_fϙ̃1523/15J 1.74d 7.2)1sasg!d*ibp67//,vf1ǐ;!s:i-YhoC- SԄ210ayzsorz,rfP2obtׂ4χχ, eaCahH ѕIRծgLo!:'b0̻tcgm׻ӫ/a.o؅ I׳/zؿcomȨpirporʊPthoul(ehdmollch ize)5QNleAӈthrough/p>D-126ЍohggIn-ros(s)ell-MediPmmunDemtxIE c-T;Diag8PTuberhiCroReسLepy Nepa`eubjsooolu>R.hH1,9Gyawali,̓igdel..adavSapkotǁ2Jσρ>. 2oi:GE;w).؊[h?qm@H3unlikareXw$valu⃈sp 2ubulloN1ھьbyM聘Bctphl0ludşroup1%doapp0haiߋK/s/p>D-1270PohggAͩhicEjAyPermaDVIAÁaurJ.Ѝl10u>,.chiff2Deed.ҥЙ.happ-Mgom`GGGGGaxtonЈill>. miigׁi>Siem@ȷca(Diagnocs,arrytown,Y,WWWWWUnrxMiamieroriveriseases,iami,L,

D-128 @ohggLookbackseroityzinfousis0)26.354loodonoredrazilianabourmy!2010u>P.aho,Бav,.o0LabdBoriz, Н#aBygj2.5%IttothBI>!dpdual’rvariDB2ъ;sho higXtPevalP1.8%o1Rngo dЍϟSɍNĦbetw)0.0@0.3%,(lO>o)?low򕜃maٜ zXߝ0І䋍bu)ӆ/4&*`̟"P1''$ˬWž֞ipZyoccurJc wws/p>D-129ȁohggCompskAbbottrchi0t~JohnAVi@ti-muno}molecreiRNA. 7774u>I.دht,..͜ouza,.Ѐni.ruzi>Diagnósticdaé,queaxia؎S,2 D-130ohggDeopMolecudMe@D ComȀrmatophyKorea u>H.im10u>,.,.Ȕׁׁׁׁمρ϶ρυkLeeρσρ. Mic@porum"Epmw> apkx@ifutaerorbidP$h{problem.Ɵ8Proprapeiaccu@e0agn2Ϡse imht.ur~reliXmZcopBl`Howr,combinȥhniquctime-)umqȇseh耀.clm-ba!`Pbeen*oyWApreimi@舺Xvons_Ǻ`weaCR-rhybrpzbloз (REBA)LvxqadvagϓsHJ׊׊, cosFura0IdR(ip>Xsignx*es-mligonucleotbPYaregD-13@b8ohggAnePațsoenzy(A PySePlaPVis@eishmaniasisatients

M.amsal,..hrewastwa,.ohil,.ajhiRRijaN.aral. B.Ђoianstitutefealthcces,hnepA1D-133`0ohggUs mHryraerP.alci a@:錰w Xdm)J)out%WWWTu>A...ndapur. WnedCgAbtabad,akan, prognڎHͥ]from凨rePAKhybPukhtunkhwaqviMethods: 1575su*cyuQyaKd~ummmhjMayO؅.Ѓ̂"ddin e.(SM0dMc0br@CM[chroCHДp(PsiHden@ A9untenum!y-/-sexums/200hBloodel8ckmea@10PRAGD:ʼnQiP쀀rhcuȂJex{huwic؇[R_mined bynzymeinkedmmunosorbantssay.loodlucose,ilirubin,reatininalbumALTndDHereeter؃usingicroab-300(Vitalcientific).llheaials/eagsoreasurY1TNF αcprovidPAmerSham/Biotrak(feKcenitm.΀0allyistribut(dataasalyzstudh-test .T0Kruskal-W0isԀɈ9Wilcoxonig-Rankusnon-n//).
D-134 @ohggIFPrhlRVanycHPXABacLong-TÄacHsσσσu>R.ˉry,.njhhi,.!Sal8Ȁp@lRTk8kova,āudaـڀm. AAbȆ.,asrunswick,J, 2009

9945>1,60353'ǂǂNjEnterococcus/?>7,821>6,818>9,44'b>8,906oooǂǂǂ%I/t_2.7%>14.67.02ǂǂǂVancomycinroughrderedgw>4,0725J48/667/tablea)??B.ُYHWestRaospi`,hengdʁ/iNackgnd:ecXtudifohastPthaticro ()ay0lpAah-?8mmunmPsmڜle88otЛmorphs ()cesymp0Bou1flammh3aCkbio*is.ur"paytt,icha sSseryptraitszlains0!ltPȟt,#nv ig r{8 (rs636832/G,s7813/Ts3757/Arwa܏xwith a`v9dataJmoleHaragn c prxi.Mpods: 320g‹#314a>D-136L.uo,.ang,.n:Fa@Y.ieq>DeLaboratopMedi8e,CH,ichuannprsity, engdu 610041, (r)Mackground:Ԑ`&eanalyze7߃XZJanuaFebr10ph8GGA(CU) ,Iiscuss‚ acssummaricharercnosocomi infecourgzpo(efRprxn!zoleasXs.Me(ds:usLISH@systemcollmр@548s6with0GwZʠfortp逨esult43wexڠhicȄى虨-hkdiabetHQorg8transplap`OPD,ng-mJmmuXsX,broad-xctrumxtibio . 9NoutPderlyC򅇄0uma1g. 2misiUord48+(88.89%)mexas89PX.Tpti(wee聇zC`reםas 2dsh 9rv, 59)al.o#usuallyiazovori.ԂPa8agrea#"q1ek oÊȳhȅȁKlbA50% -78%ø:_jߚ*a󑸟typfungGhP8lhsɆ nd.̕zd锟,7lucroidKJppljc8ere.nvXڦp1Ayg/.C-Iof@ٙ.׿߿7??gg0lopDRolyphismPCRClfySub`eMycob3tubercuBeijfamiIA.ek<>1,ȁng,.oiׁׁׁׁ׃JinρρρρӃρρ2ρρT.imρσρυYLeeρρρρ. D-1398ohggSerum(citonlqbhmia|u>E.iyajimu>,.Έma,.utsuwadpM ujisawkNakaXMi!HirosYokohamaityn(rsYMed:CM,apan,D-142ohggIn f@oxid=9rde*hPАCo-HIV/TBxJdrugXЂnutrguHAxacelo11, É.nnes<S...rgolo//,2//0uHM.reire//.aiva߁߁߁߁.ngebourg҇aléri. Universidadeederaloioean`oBrazil߃߃ލH߃߁Diagnósticosamca__\abr)Mackground:uberculosis (TB)snefheostommonpportuni!iseasesssociatedithIVorldwide.heregreatntin studyqoxts pents-infec)bypossibilitfncpprogn҆tnd(utritioncondbs,spellytexHvHnficcyemiazbjXY؇ Mstatus+bo!,r=/BefoЀafrugCvM.Methods:ongii)ndietarwnu?B-naïvhAnthropome atacolliochc!6@ЍB2xrapyjTB.הPurserumlbumitransriÕpleteloodxu`q`onldehy(DMA),ad;ohecking:armusclhimm(AMC)inyayzmulaxf995%(ipulXus ٛ tsNOVAzTantesXȀih14耰10 (71.4%)Yxf (28.6wPll,aerutoffemoglobX(HG؝XkWHObcl`in, 8thhvspyםunselcindepe(xXgYremain8Rcpt(ahigh`volve*<(n = 41?π5)r耇0ignbQbetweedez ccorXoigsrom lqbςmarkH (viscJsomc)@hhotm`o71luu `UKawd (F0.08) ([45FRx(CM}37)/onclhon:` 慀mȤrgaTisks'sґɪguwXonhA9ppbZAoutc@궎βOccursmpP{23UupJgl0 nemefj/opzP0 P/p>D-143HhohggVulvahuH:iQPseudozymxphidisךnAeyelocyeukIL)u>Y.ie,.ai,.aao,.u@Z.hXMH.an. DeparLaboratoMeh,stinaoal,ichuUnrsity,gdu 610041,`a$oBackgr:p8)unusu9aPfungauwh`(Xponsihuxe83vxor٘lcdiagnosisωhdSuraud’sxtragarʃXc`"y biologyxa`oaifyc`nommerciUkitail?.ԍequeribolNATSpinuALASTarchesРwP762-bp!ductield0X%".oi>sGenBankcnumbAB 204896.1):ournowpgth9firrep`Bnfectionausedy P.phidisneukemicatients.ccurateiagnosisombin8withffectiventi-fungalherapyayrevhXlopminto(vasinzons.

D-144ojggAbodycreening,ovirustÆ8denet@characterizofuman-lymphotropH+Rio`aneiro/Brazil u>I.enP1,...ouza////.,.ЁK.tsuki2A.ÃVice. hiX׉i>DósoXamérica,uquaxias,Ž,)In8tuOswaldoruzϑȃGJbr)Mackground:ɚ`smPdHat 15-20illipeopl8re4hcell얿(HTLV)orlde.h"HwPY 2-3.ȃP-1aɄ(duc0xc tryyenselatraTXVI- IIpuriesHix 2aancrcfollow:emig BAmc010.000-4:eargoPloodonordato@6؄P1990`nzymmmunoassayXEIAs) rzxل,1pHsam(srnfirmňbI/0W8ernlot (WB).aboAtم胱 I9vhbelsoouranspl+clinlŅ PyR :Äh@r„ ok,ŔAɒ/WB, 490esdōH (0.75%1n7ե4@5 (83,3%xf__[_Cb WByf(yrgp46-1ҒZAqm.ϒKi??2Pb^qwqap19rGD2`Po*one0rҋ''$negHreee-(1ԜtrȖz,@sȜP!Gzvealʿ8butxrabeloaA,xsmaPTqIl篰p`BρJapanXǎ viruˆztype´oclon:Цǡ611.1%%gߏwvswsanʹaHf 0v ᐲL0.67%ɋ{Aϩaodono`RioXXneirAa1.5%.

D-145xohggCOMPARISONFHEIVBND}AG/PBOMMUNOASSAYSu>Aj@mele,.oeffelholz..О,korodudu0i>UnrHyTex`Mkranch, Galveston,X,

'ďpneg?_Pwy-f)(14.3b)p(69.4ȣ''5ya#Ќ l8Sixp0(ddisd be0iߏWg`rc qackqtrݚ3-4^Oғ_b , 13(19.7(?=+on53 (80r݌ssubmitu2 (3.8 _e9`15)`ƄՆn,98.1% 1ʌw"100`3@ةT96.9%zConcl(on:ǀc8udiedys`Q̄6!@Wׂظ@ϴϚ.

ȌĀ/b/u>,˂#Uytfangh?????,ůPhimizu2Waniׁׁׁׁ.memoto.Thp. LaboratoryAytihemistry,ac8Pharmaceu+Scces,hAUnhr,elgium,7777/small>
LaboratoryfeferenceaterialnstituteorlinicChemistStandards (ReCCS),awasakiQnagp,apan, esulqFulfilluGG@gتxfirmeСY 4ur@iInotignZnt(NS)蛈@5, 6r7,8Pba{*pa8 (jzed/!-)NSnt; nclusQED,)in-etween-runVq2.8%2.4%,/(CV 3.7% (target: 10mol/L = 61ȝ`hes)""0tGlyh;00]HW.29cgd6gamh/+ePani0-0.2_+0.03U (2`,th6%.ans%stud0S0sblgre3dMlliGhUn`rRMhltuPCChemSaraJa) KQax. 40>×Hon:at@hopindynv Xsuh:XobFCCndorsCos1C֐@UytfPK傸l. 2006;52:1817-21.

1,ú.ӭosЂ. CDC/NCEH/DLS,tla,A,aNIH/ODpBesdxMOObjSo}ƢȌito: (1)HOڝÀerum 25-hydroxyvitamin25(OH)D]nationalealthurveysroundheorld, (2)otudyifferences1aluǂǂ,Ⴐ(3\hardizemeaXementesultsromlinical,ommerciaq8earchaboratori enableranspf2Z3-epi-???:.GG>i(neojOtʘ|2[widepreadriaߔ'confAterVefhXhdevelopv x-b:%uhMethodology:osswp:bilityIcurptlyaӘyps @ducthatclud?sellAXzanuf0r AyzEwibemplXuscedsmilarse[CDCȃoS72P4(HoStu)ڂ0sG0ngle-donor,Pesh-ze(zcolleLSI37!to.֩}ignIerayrtNUTechnB (NIST)fUniv8G(f.rѩHp3(`KperڄcriiaohG<=10%iis 5%ip/''biɜ*oata(o1X9%exiPUt7fY܎!masqu̜Jp +nalyWۆRRIHffiXSups (ODS{ْvCrZEnvironyH3(NCEH)blishi^Ϗϟ ׀Coohɇ܈.h2'G"Canada,Hy,ɳ`,K*USAartpsolvۀblhK @capucZ.

E-03`g`__MqSFree stoٌpLiquihpphy-Tem͈pXetry--Di0t̓Calculju>Guo1,.ʢolx2>. NMSabWowrove,A,iGeorgetownOWashton,C,}NBackground: te (FTccut1-2%tocir8bloodЂXg“fhۆ`y”,lyTqI`n0membraѾ!(8( ep9regʁexp`6-pPhaHSsuggc3modinɖ)h_^i8(g#tusUalog-basmmunoassaysÀreheostidelysedTethods.ecenttudiesoncludatnalog-baassaysrovxssialȃIsamenformationotalest@eroneChepplitoealthydultales,dhouldoteЄ.׃ucciv1de8opwoiquidhroography-tem8sspectetry (LC-MS/MS)ʉddetPquafyerump.
at/mol,냷ׁs߃9).ԉdirq̝Ssltrafi1r(UF)t 37 |o>CQAbfrafӟ圚*HaW.ɂXnsim/z 289.2/109.1Z29111itorǦiinard (I@gne-dOL20i>'$I%weXvalid9;䇁120qpcom(ed;gerificref@nc HԨryd:לin-etween-runpis99gavȄef ia@var3s (CV)쯨n 4.5%A@n30g/mL3.0J) (n=15achиoveHXg86%104%gPAHnearB 20_Tevitפe|CV 3%Gg荈correkrwell]:;= 0.6986???i>ق//- 00100.9807,=h.Pag9χɖ%3ފ-(6DQfePubjX0.5)4.L)S-28.7큷438Ԓ2řԠHishs 4179,76qg;e؆9.?w'' (v[50ealthyK٘ 18`ab)GßPlonXaopp>wobaQ@quantifykn(;ױR{wuhH70ǀڅ9is @aroblem/@a_]wmost-дCquHssolumIo`8faurn-around-tim??8

E-04g`__Non AytiX9Liais25ydroxyitaxhemi؂0sQmmunoassay///,u>E..olmesE-06(g`__Hɨ7Ah(yA1c'o oneڤsur"ua 1-yz:0equythx pdiab@sisk-bdree҆u>L..cCloskey,..Ӌkle. JeUnPrsospiPPadelapA, (whicholbgiaφphυ.ʮmiXaQӃʯ0cyousx?╘aQy (soloc@lim` ˍ_Du>MbsSPri@\whl73ϱʉ)crPh'Septx09`hAugP)sspec"!numberf1Àceasurementsadeuringhisnterval. Results: 170861ine 1-yearererom 12279ati,mohwhich 8952adnlyolo7(72.9%fv; 52.4s).Ԅpainder 3327?(27.1g{seri؂z(havJworooTwi@l)ompris!8134>47.6totKnumb0(n)х4ǁperformedȇividu0rangn=2 14hccordodistributionq68.5%=2), 2h3h6.7b4ɀ5ŅӉwasorrelhbetweennWl'aximumandz܄H(r = 0.117lmajority_/(90H)J2Y3,ancxDAuidelines"dia@esenj85arȋGtSisampl؂8defXdouldcluHnot crPlsxrircumstsu as.n-lHjrespect onitng;8ata7"e@effs"ahatXKrreonew?׀3.lencoubHiCрgacicن hoone`eltCosaigh`acieaMAlthoudoexZvyrepΐv,b1xustit ciorgisk-basrefɣJ9()>p:Qr7e!؀onabappro.

E-07gb__CJv(nalysOfzUsefulXFaGlucose,baAEmAveraȁ,sӜ.TeFDiagno\h MellsOJCgPIntolHIIȎaRYPopu u>O.ojim0yi1FaculKMcx,uwaitnrs@E,)Mubk͍p(Heaospital/Djbr)MBackgnd:eclglyhemoglob(HbX+|c0͗Ҭ9gnas -9≥5%Kev5B4dif((.onP ˩agDuYeAG)`lpnd:tۍ1.BaimcurXtudy9҂Hai血 f):i@΁mHboldisp@yiHegvType 26.Medsed΋ψXalЌʇ!575 (232M, 343F)T2DM.ubjhclass)dyZIDFـ7syndrome (MSh!pchcZ@(ROC)`uaxaxCerm҂َMSpQ>Ȅ arHuff}AGAG,zErٿzooourhort16/C.8 %w, 611620.8Hp؄ly-Dž녧ihi?> (IF559.6%), 1933d 4377=_Y3ADA֏o8ref腸;8iAH (0.989; 9CIy8742)diagnosiÀsfMereheameorbA1cndAG.ylsoadROCreasꀹdiagnosiIFG (0.719; 95%I = 0.647 -@791,espectively)Z9metabolicyndro`(78 (W.600S56).ԁidealut-offointsithhighestensiity (100%ӄQific65inurohort#C= 5.9%~= 6.7mol/Lsealuesffnt@commendations1erngulines.
E-08g`__R1RNaLTypeăooolu>C.eng1,́hЁ,āipris2Aouׁ׃ׁ. CleSen0ry,À,H,77777Colorado`en8O7Backg:cașBtinxacXi0hg".tɠb`yautoimmuner!`riggXvirinfQoxX8bul`gdroiroducpзAa-cЂleadHanbsolude؂wixStudiXhavv񉰅Ãteknowq@P(IFN)-alpha,ω lehafhJIbdouble-Hnuclecids (dsRNA),miqPxssocixdtߎ>.uchf0߉xvo؈9d8tȊk򤜈6opڃo؉HstearowxhowwriۆWremaȗobscureOethods:(utIP-B7.1owhimo0vuln8I i 98harmfactorspȊ/,75usen(thjdemiЌ'oI:CSTZ-in@&'Rʉ I98s`f:2-5Aped(Ln/ienzymI(funai(g1tpp!liR,layimph󇟇;?=e󔀃1hgni؃9aBŸCM.urLJ߈لewreq_poptosDnclus:urتzroviXewight1mculaa'sWGGGjm0su xnapiWqp)‪seXiginhibi$.E-10g`__Valido`hemoglobA1C9ImmerlPLCjreeu>D`.›h,.åbonneau,.ang. ClAC@ic,@,H, E-11gb__Stability1,25-dihydroxyvita239huerumǃǃǃu>J..l-KhouryP/b/u>,.ailla2Kosewick.ٹЁׁׁׁׁׅWׁׁׁׁ. Cle0꒢,H,!灘ϒP@Unxrs!brȀ)Mackgnd:''! ((OH)2D)sbiologlyد9qPxtl9ae؂Iu䁨ciuhphosp؞omeostasis@phyDj9215a60g/mLZem̆_3؛,!importads[re`h,ypermiaomagnespahyroidism,seudo߀ڋ-depenets,ultousis0lym mhmaryĂ߂ڇʌ.ȱ ,rsittR@avxabY9ard!`Nj'oB.bjeoxe''%ǍĂXdiff0disncP(`ayp۰_^ethods:ÀommercialharcoHstrippedumanerumaspikto 20g/mLf 1,25(OH)2D2ndD3,henliquotin0.6Ls.neample (t =0h)ctorat -80°CHdiately,hiemaining,serei r221, 42roomemperatu(RT)darkrTndlight.Ӄnov$agediff@ntimeerv: 2h0 8 24hz, 71r68ˁY9673;NconditionHawanalyzhbatchsҁlyeveloсpiddquidromatography-t(emasectetryethodtability1extrace(fiؕ1posJ 70%:30%2anol:w rautor ({osby-inj)who2ys.esultAsrescFig1,oth?=ab КDqruɉ,study (8`qڐ+).Ŋ i|=i*iod(S䂈Conclon:a`Xs.

E-12CPohlg1,..ennill''''&,Ġein߁߁܋H߁Ņgatskyҁittleǁ. UniverȨMissouri,8lumbia,O,Albertin؂leYXbYeshivaՄn,ronx,Ybr)Mackgro:ǝasmiȱrXcrendogenous1ecre8urٳ߫جAeamo)is(xHdocuAeЧWorldealOrgan}(WHORR 84/510)y.xwقB8a$@h(Xde mif7s effYy>sѼû8rix-appropripod-kcPbowihu@PaᡴrO;FhIq0six(sat9ip)9B!c(2-diYreوphiquiHgraphy-iCC-mAsGIDMS)ωωͬ ruBalyjDXvOs惨nRxmoaccoHؖsirxXcedӉ2y'GA.ne-w0s؋PiaقKramer-Tuke8djust:텈iHeswas@scompa ІiI/(n=9,ɠ36airwik@\eachon);А}< 0.05#sr9sthlifhnt ވ\-疣SAS9Gȍ:etween-labin|aGߨBNz!(u+m''fOɬh-/figP).Ճ&usn,ߌ兇ang1.04!1.99J23)(showuvcePAf`77+WQ33S48R14WWWWWWSObo"yh`Џ “*20.3%7.6%v{rpnclon:he𥈯onfirmhatÀtandardizationf-peptidessaysanpchievedyrovidinganufacturersithooled-serumlibratovaluesignsadidateeferenceethod.

E-13M..ERES1,.ello-Fujitta????>,.revisan.izzi.Lj ampan2Dintr,PoyaresӉufik߁߁ܕ߁ސUnrsFederXSaoaulo -UNIFESP--razilã,www؄wwA3c0Fu89IxnoPPsicofarmacologia -FIP-MDOOOOOiiOOOOOOONndՊGG@Ibr)Mackgro:h-wakeyclesgu0kpH_ircadiphomeoticycesses!troprimartsbynchiztXsystem`reporytoɯ htosecre!h Zdisortrigger9blem=h,fragٮ,xals,etagBshift-workXisbas膗 habeenlec8鹸/)pla0W!amex-pa8physi9y.urjɊifyhlaboXlsÈicXR'w1asurapmorpHpyividuHッB}Cinu"osiirway( (I)vscoi roljou!.Mods:זe54wp(`wxn)Heartxstitut≡g54.58 ± 9.63pMI 27.853.22,`h28#򊛝0`opaqhZe0min…'wxpernloodlat 8:00m@Əm[@enzymmmunoay-ELIM-p8IBL-Hamburg,Džxany.ӮccґÏndHv8 W(i‐ne@yNOVAconferQ0er)diferbetwɀmesultP),?&showY{ly : 17.36I11.3g /L, 49.27.72419.0Ѐ(p = 0.01ihaxignPt(uch)ΥZ)v06|Chl( 籟Ԍo0)in:WdatafoXЃ'Py8flusecreOgg`raquitieslÀoseoheontrolroup (nopnea)hil0u@eatedSAavencslevelsfelatoninelavoringaytimeleepinessatients.

E-14gb__Dopemaandidferencexasur+procedpordeterminon)estradihumanerum脯u>J..otelho,Shacklady,.hite,ȀP.esper. C ersDisCrnQ,tlanta,A, 5E-15(Hg`__EvaluGrowXHoSuefOGlucoxToleTKQBeckmCoXerq xUlsens@hGHssaywwwtu>J.Ėto,.„os,.ricks8P:obald,lg-Schimn. Mayoli,och1r,N,
BÀackground:cromegalysharacterizedyxcessrowthormone (GH)roductionndeadsoontinuousgradualcr0tissuemany-morbidities.heiagnosgene0bas؃clinicfeature{firmlaboratoryesglancluddestPiofreBinsu@ikfor 1 (IGF-1)tckGHuppsaglucoselxncP (OGTT).҂PommmentightLnotelev8d.nfortunply,oXcompXbilitetweenimmunoassaysase@Xunimـ@criain@tև߇followχ.urrp@dadirve@Xn@?:Xg@fX 0.251.0g/mLpend)i'~pticulartud2RechWÐxesǙ8publishPreЌds0gВт atxYrnsxveqacutoff0.4E-16؋g`__D3S`-am|rumldoro Me؞,ABSciexPI-5000͋HӇtryymWWWSJ@.֋DGugp1D`.olmes. UntyBrshhlumbiaeartLu`chnstitute,cou(,CaaЄBRIiopharmaceutResearchÀnc,ancouver,C,anada, 30ichj nx`with 2؄}Aylert-butX(3nortex)llow5ҁc8rifug(3rpm,degÊ Iiגorgan)ay`Fa 2.2LŏndorubedryHwnlؓzt125m>Oed.PLCSN//-/.Ac)ufydȂOOwOw (A)J(B)ahzduQ20AD/CTA/SILACHTFaЌnGei-NX 3u18YA 1xH0 vxhR55ºC.radiq϶+8pxtely 6.ˆatruw/.Ґ`veri像1four-P `diums 156T)S'eФ#PA/modc{8CLSIP-5A2|*poH,0mitYtۈcrS/Np黼!aris+a agai(ieHsoat-a-Cxoimmunoay (n=138XIn`ncoleveXrelBts (cl,Jc,11-DOC9deoxy>18-OH-okSpnZthsڂ _diR.2.0.: 0.9984-99AǍ+97-109%`10%tH.OQasiy:1*~"Q<22Regj(Px-Babloketwe0HMS/MSRIAǓˋP5= 1.14x@-59f@clț4utlier3hauIrBi),cly,\havehkidneyse.o7ZHeptshouldP1lȄpiau!WnoהQelopHaobustqu;ЃS^ldyABSciAPI-50syIll)sXvtIchaqKsubairythropoietinssaysp>W..oberts,.͂am -Messerlian__\2__XC.elaney3B.louffe40u RHudewig.ood'߁߁߁,ʇȃei.hompso. iiׁi>Departmeofathology,niversityUtah0alt(keÀ T(灘WondnfantsospitalRhodes@d,rovidenceIiყQuestiagnostics,aliaAςςiςρSiepehcare71Tarown,Y8Abr)Mbject:ovaluateheerformaharacteriyaewMMULITE71(EPO)a* (ggggdUS).Rel0:POeasurtssefulndnemiaspolyceхr 1-steponoclonal-_wich tangle 30-minu0incubation.(rast,reviou`!/aptHtiboda;deto@twoequi8ww ulf8erime-to-resu8extendsup 倰prange (to 750IU/mL) eplacˆ''%thG)m8alsoedulot8ariabileds؃_]solid-phaseHzylabdhluescrmmuntricȂ0reportab1.0OmLstHard0poHO 67/343Pmi (ǕvBeckccТ//,١2H؆(roiC@udipwe(t!t 32rindeporator,22000(agakiotT阬217!oydiseIsampl((kr_߆yld 7pool!y胘b(crosk.e؈id :χΐߎي[186es;acis(c pannGe);엀`0d6fmwwwwrmPxbk (LoBsΠ'D)QaccordʃZCLSI17-A;unz9 ijdefЊ닀ق:20%efficz[CV]poinf؄9ʨX@170plyyrsFil(1,Jc25inu^qXKbw0: Kм|follow)g Rk:w2:= 0.96U+ 2.57|,=8 (DPngA( )7-8OLSסד8tot%CVdrom 6.616.2 (3.4i8.8in-run)˝looi10.3i6oid❟deȐxP@8xoy0 (#9XA30%bp0.5Vespveݜ焰w1(c`dicjth@highȄAihrłk{yielal 95%429(median:i6`EtamiwpC_^p0or@#diftgs ryeastÀquaresquations:MM2000 = 0.975+ 1.63IU/mL,=9;Q1QxH06 -82z.
,..aha,..oofnagle. UniversityWashington,eattle,A, 2ra-By!5.6%*8.0% (50pg)7132ܬHimiPяӑ썒0.625C.te2lyggg18熻E\a.omparisᓑRIA!)PQ\P1haДbiЄ0.75,Q1t-4.1rPearcorrel3(r0`)c31xsЂxam`aSampo,o߁߃o߃of9y潹showigahubetw9oooogs 2.36,'Dw85.21>D63aAay((1.08˾hicJqvid`0tex躮a@rixmpn(,setlConcl`PPGG@effۆ!|x^8bXLC-MS/MSgʁ8z//'upЄpioverBxistclin@lly-urexcellqlXgo.
E-21Xg_[SimxaneousgNeu ept 1-363IHhumplasmayÀime-of-flightlectrosprayasspmetry.

D..endu1,.guyen2S..oldi. Georgetownniversity,ashington,C,NMSABORATORIESillowrove,Abr)MBackground:europeptide (NPY)s 36minocidwhichtsripheryၙvasoconstrictorndatehntohegiogenicPY 3-36.bj8:oeveloprapid,enX ifHHPLC-QTOF-Еhod0simultaneousterationf1aHumanla@ɄȂquantitFQ`sxcarriouts'!system (1200ӊpebnP6530сer ,gileTechnologalara,A)quippwitrseha0CH>18b>8lumn 2.1 x 15 mm 1.8 μmarticlze (ZorbaxB->)].ÃaturxHma at 50 °Cob#sBe2%ao0H0.Pm(i.JetHeamSIerfacpomodؐ{ʍ js:paryo`ge 300pV;ebulrress3psig;ryyg9 L@W−op>; 7k;ragmP[skimm6o(po RF 7V.C/accu trarecordacЄ0rxe1-17Xm/HzI)lib`aaibasubspVh cy (<)pm)ʞJti@yrefxn!es.a"ѐcHro9Aء1u`s}extpdyn c (2 GHz).llac(rMHuoftwa() 9µL٧magg(M DTTrcKYifreXM-ȫrafi1ʮXi(30,Wut-off,͗ipore),2ifug2rpmЗ 37_]oGG>DdH0%)4هr:d4gWlat)deprotez5΋Gu$Pnaldard`Pisamp8ꉿ1K5ȘKloaiLC.peptiU(fIɕ)only+hoc"803.20380ك(d7׎4ױ/>-805.240810085h24ǂǂ2ǂ>-`7.03450>finjXY h20?6{agradiYsH(XŁ *eriod 6.19.220-90%,r9.1-90oj13N2 im'36,GSbetwe11.527X39n'R*LOQF`|0ng/Lcov8 >`lLaritybgo؄-hng /CVs p%/.2-2Preli !indQealu,healthyalPİ;3-0.67 (ަ95 >onclxon:eelȉliable,pإ0uXsimaneousth.E-23g`__Sseasѭ,25-dihydroxyvرDןןԂɠB>HSeabyX/MS___\u>W.u@8-Couch,.anks,.hnner,Дhhou,ҀagliQtiagnosticsilsnstituÀte,hantilly,A,
2.Ԅrontint alevel calcium"phos rusnblood. 1, 25-dihydroxy_gg_g_8 (DHVwsׁׁ׃b>)activer,ducedekidney.easureme8 irculating)import5diagnosamanag^disorderύmetabolismIyesplsosdiffer`iG`hypoemia‘onitp؁sithenosteodystrophyrhrc,Q0e.?!purpos tQstudyvalidatho"precPlyaccurxm#ׁׁ3߁ފPhueruHe9ȅ.,ugged,rsensibliquidmatogra-de`aspecȈ0ry (LC/MS)huqtonuoo?g??ׁ׈?߈??87M"sPamples,iborhɂ𥰒YfirdeliprqheXpik2deuter-labelsYards.fffiPynr`aextrԃ"ivzus4-pyl-1,2,4-triazhne-3, (PTAD). 40 µLYywahIҟlyesultZ;csaybyerQcorreAienhi,rov(onscellnourevio(ւ,(Y = 0.96X + 1.44y1.00X -A2+rĆׁךߚŽzh`7%rozanget*Cabl fh 8g/mL200l/10 .̘Xars()!sp ax|5H#o|JymietNjǍׁ׍߁ކ Q be7? 2.5sȈHavP.oprryobw4nЈnOwOׇׁOׁ>.׍?ibilaҿԅ磡diffiu8ҀreagAlocolumnҩGonclonb?kidXyyljljNjNjׁׁג߁߻_]LhadvantXȒDHsjK)hs8qobta@ɠ ipXrwioulucfxwARinjohowseйQE-24(8g`__Ele P(cˋfTH 1-84rXslxchrohartailureWWWRu>D.RUSON,ԬutrS.hn,.ҏseau. CquUnraituc,ruxIs,elgium,E-26 g`__COAg`Supelco8Plumsma/serumo `etiquidh8atography-temHpXetryzu>D..endu,..oldini>Georgetownnry,ashtDC, E-288g`__FIRSTVALUATIONFAPILLARYS 2LEXIERCINGSAY{S.ais,.euricN.eroPP.ill. Unryospl,0ims,Ʀ(!1c>eyi8rkoniٔHglycemicalJinetpؓHs(tؚ vousidhp-pPiiqui(HPLC)immuno.ȣwePporYsultsfirevaluCaparlexiIng ֮*analyzcclrophoЋpseˢPVwhobl!XpriapptubeEYn)aXp8owaoughpu40aФ(z:ZhxLav8؂ticond8.†ڃIEDTA-`tainBq3ob)daily paU50Gg 3.9% (19mol/ )o 1661Džcom oos$lM  (V( IWǗWǗW,io-Rad).infdmofreqtlPtІ@nOOO ;(؂'''''i,rbamoylahemoglobhqډsalsotedOp:n-Si-cCVӠp0oan 1.98%2.68%l(谸exceآ ϔ 2Q2O 9.7€) (r=0.999Mwrre{with=8NCGGGGB[ 2] = 41wwwwwr] +`303]3,=Mo8,*ȗiexlIrolf(6Eu eXRe ̣GoduKPrYmme 2010)d1a9accuracy ,QǍ{1greembIFCCarge)Wrgg#d`no ff measurjPAh@7fo։0uch,ŜD?onclonsshxAat{ 2lexiercNJ"fullf(~e(ecessaÀryorlinicalse,ndllowedoecommeitsmpleptationnchemistlaboratories aoutineractice.

E-29gb__Puveechanismshatinkysn-CithevelopAforonaHeartiseasenЁ(sType 2abetMellitus'''$u>O..ojimyi1,Ȃ8l8had775277TRah/.into߁߁߁߁΃bda. FacultyfdicX,uwaitnrsityE,Mubarak͏HȒl(Hospital/Djbr)MBackgnd:ecevidenceuggestjCXheoIrhibibmarkglomerularilt!8hmayl(amportarole)thathogenesisqxeroscl1acUhRdT(CHD).8studyalusassocizچwɅXdi89non-lHDiskorcinc 250!d.VMeds:fasPg,su,ucohomoph-senivÎة HP (hs-CRP)pdiponelepE0HreeindexfullipidaeererpT2DM72(96)2X154)hoKalsop`ifipas@rmo-ricroalbuPuric.ñųnthroptatardq0subjك_ba܀idegIp4`(HOMA-IRum(ls ( 1.4g/lpcrɕ@3ivar0ʓlusqgamok8aЉ)p@ntionfQp)pa ys`½(ʍΙbl(1or0tRbZelyYrelp (r=0.2!_ 0.35)shown49[aI0h(`Compaؕ ؎,߀ea(igncP(p<0ѩp18s 13 µmol/Lh .8.2υ (3.32.1g/U(Triglycerh2.2.7m;蠚 (0.970.62AL)lXrDLhp362%ňi/.0f@Hjustm)f(PlogphOL) b?9}hrȂ(OddsҒ9`=2 ?3ڎnemia 2.8oj2.7s-cفz8.9cz9)Cou:ӷiha@Y՛kYXinflamma`rocaccnloIȘHcPXbeenLw7ޠtucbYvolvmalexcellax.Ȑver,sY߾߃(yggP -hitech`smgobeyoHikehogesõ idneyisea(knbׅub1әardiovascorbiditortalp,1Pd ̚߀haediPmarkيׅ)T 2ab8sluh/p>E-30Ёg`__DopADVIAÀaurK..ickXon,.hakuS.̴Yokoyama. SiesealthPeiagnhicPTarryt,Y,E-31؁g`__Ass@Freoj[BeckmCo0hAssA8h774h,..achler''''&,̚P.ogerO2>(ii߁ׁi>ProMed̕]iiToledo,H,OJ,c.,¦,Aȁі?@kground:͏ircu1wbAcx萴bg.ꔨfاc eakЂValb oporexistPs(0.c蹀bQs`'ne,ӅРĄ`viApparЮ׈AFTC feHdPtho;1: sbrid(ysAy(em(rorytechnology1unGatnع>so(vgʈHa!nve<̀s:׀wwwrsampxom8`feZsubjrGimmunos??UXelxIAWtw:ÃOONCOOOOO.ynamicang10-160l (0.35-55.5mol/L)?;83-22*ي!hX@de9utoPsftwǃlȌ-p,˕IdcomisonkJǔǔǔłV8eulenmg`with/ollowsep.mÀialysiserformedteferralaboratory.ethodomparisonseresingne-It*oftware.oncordanceaseterminbyinpretationfachd’srrespondeAbvals,shestablishGFif .elso0vigatĭcharac8icsbothmmunoassays.mcisш/*twoeveXmerc(lyvaixl`ontrolPr.
E-32؁g`__IhtՉ}Ȋ|Heaإ@LimiH(o)TSH,ƛ FT3RocModHriYrgi pop%ag@0-99wwwtu>R.orizzi,ǀirani,Ѐ@oa`SgarzʁZulla,ŀcelli. LionicoVResenIy, E-33g_\uFCalF!BioavaiTestosteÀronesingeckmanxIestosteandex-HormBindGlobulinssays.

H.yyad,.ajechowski,..eldkamp,.olhgwood,..uzzi. Henryordospitaletroit,I, concentrationsknownstants (VermeulenÇEndocrinoletab 84: 3666-3672, 1999Aimҁ hodsoalidWPGTnur8stitu,eujcbnXI®=0.929 ;ۃ9113Q 23.11؄9419ig);Za26791//-375,"8963clЍ:vid cXte,venlialpnP좾whRvoili( Aer@0a7XyhmunoTP *Qepxroneaboory.a>E-34gc__Auanephr@sqPlaPMu>B.ʵeys10u>,..raham,.oltׁׁׁׁ.̰Hk3>. ARUPstituCx@ tPathology,ӔakPitU???؄??Wrsap `,l`dHAςςiςρDepartYnhrsЀUtahehӿcXCerOOMackgpnd:ǜъIn`geneȞYXʵ9camqbolism,ualsoducss2qpheochromocytotumo(4affPqs,os2chlo(@"d8gl.ԅesRachar8Xhytenuelevrccwus8isH1lscrehsu|Pde+gdPAjugfҥuhxyield`fPeeЭ!ultbwiar؉dispo=caroxy.'p",owe@,@d@iagnoÀsticmportancestllowsororefficientxclusionronfirmatfhereseQayperpla:process.hisesyhibitsighensitivityndpeciрaanalyqducedytuXeoal@studytoevelopvalidat-throughputC-MS/MSxsameasuringPXephh8inuman0ma)aiddiagnos8xpheoc(mocyto`1monitreatm1outcomes.
VDataZ/td)؃ k`>fhOOOOLNǂgCom8PH/cheI; n = 252)wǃǃǃǃy0.933x -H015O(S2߁p96WWWWWV16T32WWoWWU3WW߆V9WLty(hInmol/L߂߂߂߉.004x +*3'!%rror.0270(PooRecoverg (me(5ptes,p7104X%2.8AnalytMeasureBRang؅/">0.1X50[77777777_TotxImpreci?g______">HɭlӒǂOOOOJCV154/_____04.7c3.4gowWGGGF70.43O_____5d92gtable(d"1E-35Hh8g__EInsulin-Likerowthactor-1nd indingrote3fteriransplant*J..Հ0oelho1>,..asl>1,.itsche<D.1V.omes''$2''0uCFreir'. Federalniversityfyaná,uritiba,razilggfggDiagnósticosaméricDuqueeaxiasgjbr)Mackground:heshmainourceQinsu-likerowthactor-1 (IGF-1).irrhoatientsresHmportaPreductionplaevelsZndbinding0oteQBP-3`Hormonchangesft(op ts8nt(OLT)aveoteendequatelyvalYdet.ubjeoHmineJE-36@`g`__E[TVitaԪ:I2ADVIAÄaur//-b>®K76ystemOOOLu>H.ͪZino1__0u>,Ӻhapman-M gryggggf,.ahakian2A.oH߁߁3߁߁Tiorne煯ʱernez. iiׁi>SiemeHealthcDiagnicsarrytownY,WWWWW???,o؞lehC(OOOOOOOOJBerk0P29Background:primaryun0regulateblpalciump X@Odef@en linkтicke)oacia:Pqtmajtyp/:rgo"ferol (DX__''`choleOOOOOH.o m:vAmetabol dyҮ\o 25(OH)enI t끧pkidney ,25-dihydroxy>,͆`aGFynednggłYuhX߃tbu؂,l`serXrefXtbody’storagւorXIʁc@ympto.ϛ (US)aspop0ToÀtal*,nutomatedquimolar 25(OH)itaminmmunoassayoreasuringoth2nheDVIAentaur(lyfnstrums.hiss18-@uteompetitive/(wirrange3.7-150g/mL.E-37؄g`__Pg brchctOHU-D ___\u>VenkQh-Murthu>,..ӝh. MedalogyuburpAualia, th2E-38g`__DeÄRTriiodothyron`:hHPUgggdu>P..hou,..anks,βHatt,.iscoSman. QuDiagnosticsichoIntute,illy,A,3ϰb>)Jom)ЧЖ1v8fromx41dexpsUnlikH,򁯁 >doespHtimIipormoHHepead___W`Hn,#block ggggg9res2dh`bdpglsduexcsrol,(hibȄ8gshu@nwarPXAٵIequяhespr!tdowHn'GGGGSybod8ul 赠xdemptuQ(tiplpnzymysfunbhZ`ys8Symm@聙saXshypcidis3includeguhachPmi`,MSrritabilit@flurxanxieтpa .03lsoi`sicku%syndThtuvalidPnew|orXasurA_helpAqd!njnjÙυυȴͿ:߄߄߄߄ߜ,#topic!stؘexXctuserumrlax`fte(cipc"lear=`injeo!HPLChum8thPAem`sppm hfol81.@ay:dymds'OOOOKuange: 0g/dL920l); 2Amit1quaȉ (LOQ)ׄg 3poo0zS; 3.sionaÀseterminedyeasuringT3T (range: 2.5g/dLo 100k);nd 5.PLC-MS/MSradioimmunoassayG@3emserempar(for 116pecisρȁY3ther~ypeserumllectwithse`attube (SST),DTAlaP,Zh9in`d)ojׄ0ndividual0Thefh8analyz115}]romuthyroid)99;OQ! (defkloweswin 20%VP3.is:@-CV2.1-3.7%rtotal2.3-4.1%苇Տ%?Yww_w1.029-1.400///'=ww(璉욷.651.91߅߅߅߅߅߂84`Cpڣ fow8܁%:=1=1.55߅߅߅߅߅ۂ7;Wma8w-0.4998;on߃84߃߃߃߃߃߃߃6תתӞablish{7-263.Clu{7thod(xce`jacacyzrout߆'htIisew-r@onxyllzaneerm4iiߕ.E-39g`__Evalu`BoTurniMr0DPЁJInflamm9yis8eGGGAG..anettiߌnj1>,ͱ.ƀas..ӂ@acva''''' H00C.inroWW_WVUnisidadeeddoioeʏP,BrazilX߃߃މ߃߁DiagnósticosamericaWWTYbr)Mackg`nd:hronic/soruchb"(!s (IBDs)rohn'Ѐ (CD):Ipath8Ulcx elit8(IUCactabsm#8frequocihd﨨s@oste0niЀcorosPaincriskyftsWPprocess:էltbzle ngoloss,satbamplifi byrdeleHiouki0 9sdrugdeinabpcalciumobj!Ќtudh0eeשv۩tdwةwBD._Ms:eB100, 2050eaold, 3862puswoh, 56o (36D‚b44PYsex-cQcrolfli`ntpxt0tacoHcerumvelKsxrpd-pptelxdp` 1Bn (ß-CTx)LXctrochemÀiluminescence (ß-crosslaps,ocheiagnosticMannheim,erman).ԁ refervalueorremenopausalohndanasesshp0,58g/mL.one턘rdensity (BMD)eatedyual-eXgy-raHDXA,rodiAdvadluGE)tumbarp(,0oxim`femoneckBtotxhipcriteriafowMDa-scoreqrer2D.bsolute‰*؃1؁istFeachatiento`dPd analysis.hitneyHXunivahultendal auemployed,two-tailxp< 0.05judgxbetXallyignifhnt.
<@et="10pt"dth="a>E-41g`__Per0E{1Di@֢ aProductervelopJ-ovaiP`Isale.H8peight="10pt"th="a>E-420g`__Do "dI8s" shyperglycemiaur)3-hourGTTheXchnYdiabsn9gny?u>W..in@
,..ar ,Ԑe0rhi>UF,asville,L,(iSackgnd:bjeB:valureque0trrglucotolepcP0.؋製iamhaskbylini؞cl_YifkaPplax>4d(YyPatlyQYbecaufxhЁ 炖loadssXaiskфet/xyposiW`}Jtorknowb ic,eakLTXuldhQonyxce2mg/dL3rare?257172175).ut:, 33Kdef`dsorm05-14&), 25poor≤,7high15.ce؊per0characisticuranalysis`mhat,@rDŽ*,halarga{c(AUCR84ag.6725ǎL_.54SimhrlyG73E82W慟3At-off{ 11.4g/mL蜨*aensiity80%RȞific2.5݃gt;3574onclus`:ircuacXxsxHAꩣ?@ally.Ԏ(abil|ێnesPsXizp.

E-44pg`__St%ArzVita ssay@L(Gpy@Ӄ///,u>C.al<8>1,.ar@,ɜub2P.illiams3M.ernǁ. LaPaxlogXNewӹhaleu,WWWWWUn!0RSydneWWWWWWQWWRoyPrinc0lfpospHl_____bNhBackgro:sAPass耩0@a򃠿9chiccheck 1sulpumbgrequsimmunooq2iable4sujbourtʳzre@eoHuѫth@ghp 0opIn ras8automυWPcxcopeˣ9Ai)n(icyjci0beened‡y-exiH8oo<((modHh s0Tlaun @Thatudimxcomp32g7knis o2e8d'(MWȆomsel170hrumamphichisplayᅀH q[croX muhggevid6liquotst -20__\o''>C:analysbatȊ3h thawAyeaff0.wہu‡qDiasоό(RIA,)HAviousxA{bet;2i``j!idrIography-tem8petr, leroids 2010)alsoR5ǦmiluesqfbbotEDS (iSysRoJSiymarkDBihnoclo|Axxt;25-hydroxybߔ߾oߔbhAll韛h//D2ndRs:npephes ,lutom@s rrelwewithIAK1exceptiЄRoche:bbott, = 0.932;iasorin59;DS47;660;iemens_1.^r ho@yittle@etween 25-120nmol/L,hi*Sthisangeor~x:ggaaccurtstevels <25ׄ Z+E stantiposib snceXI -precisdiffe鉥dbutҏz? .u>C@luLten(ʓimmunodemYignifntimprder(ma"compaqǕ.׋ moduccrozlinlev%Zzi!c MPtlabo𣠂huldapir|iordingly.

̓Xods(act)Delfiarom/)w8)1235ELF8܉এym=؇ iȿHoeasuo@ۅ@wq;R,0nڀj,㦉-re0ʒ%, drif`nـidarddi!ecQJbJFDAuidexlid3GRc:GCA:CV݁뒱q10%ydXa 7773nлlZob0㋿yQt 0.5mIU/ma`a0ځQs!0-5000s,lrequiQ_HgnDEQ4( ifutsOp)v𸜊9104% ± 3.13KyexpPWiQtXpraookT蕷ĒBcلshB robmologlLH,STSH)GDgHO poolIegЧIr1_0ؑJ.ɗgXggk5%ecoЗJt,93.668.8ԉփio`h(1017.148Nww}onPslH0)j0.38% 0"b50,))ثo9IѶhuspost-partumCט׋)_Zup1nÁPlus8g 7_____mexc؅xbohe$caneÀsedeliablynaboratorynvironmentoeasureevelsfCGrHhumanrine.

E-46gb__Variationsndssoc1*iANAT2zene`thype 2ćHetesσσσu>S.emiz1

,.ujic,.stanekh.֎ja-Asimi3Prnjav`4Begoׇׁρׁ.alenicaMlinar牷Hel片Jrׁ׃ׁ,.ausevǁ>. Hׁ׀University)Sarajevo,WosniaHerzv,ILjublja_lov7770H77ClåerՃGGGGG؄rHospitHTesanjDr8)Mackground:-Acetyltransf8s()srug-met0lizing0zymehat gtvblepopul[olymorphisms!the Ы;i>baveeeIJaxicqeffcy,`ellAsusceptibilAPcancЁoromplexis(eclQϰzBð4iskslsohgges.ԇfirstudyerform0rom (BHhich̅0ypathoysnmxitus (T2DM)examMeds:ɸȄnalyzP"requencBy*5RZ6leles,4codoPlow]activX, p63)iQ79onicbjectwuw1ot@dysTaqMan®NPǁAssayID__1204093_201_10,esplyqal-tiPCRА/iLightCycler®480TSym (RochDiagnoss).arge-s0hatacocȊcludfa @plalucose,bA1cIsupe8triglyid)toDL1xDLhooltOurdem)nci @T(341T>C)6 (590GA)BH`Oxcasi.ӇnkɁ`igniٮ difpڂ's-p<0.05/)01)0twII//.C)R2.4-fol)crd{do(adjuR =1h95%Ix1.10-5.25,x28OcXrar4de5('%|0.229-0.43.ur)GVh0ykagqubriuD’969s'''%\buuhaplʋ\Pdi׀0/^wʑ0CosXߛߛޱ[appearao9importS@h/+m.tou (f89mechanr(?tdrug-metabolizi1ippotialE-47gb__Accu*FărPRenPA Saicro te-bEKImmunoayWWWSI.igg,ʲyea, pAruz-Aguado.À Diagnosticsiochemanada,ondon,N,
E-48g`__ScrȘɃHptlismP̑ۮistbonoooiL.ans1M.ƂJPinXroWWT2WW0upGZ.ӀeOOO,Łuxftiçãw''''. Unrsidadeedloioan,Brazil߃߃ދ߃߁DiagnósticoamcaWWRRENBackgr :ϙ(RH) `inXaxvalentonÀdition.boutnehirdfatientsaveecondaryormhypertensScreeningcortisolisms causeRHs⁐ra;allyndicatedP'withlinleaturesQCushSyndrome (CS).owever,anyAthe؁areighpreval8generpopulon,uchc ripeto